Xona.comDomain HacksSuggest


Over 300,000 domain hack suggestions.
[an error occurred while processing this directive]

There are 4,568 domain hacks for words that start with pa.
First Letter: number A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Second Letter: number A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Word Domain Name Top-Level Domain Filter
Word Definition Domain Whois TLD Description IANA Wikipedia Length TLD
paaldefpa.alwhois.alAlbaniaianawiki4pp..al
paardefpa.arwhois.arArgentinaianawiki4pp..ar
paaraphimosisdefpaaraphimos.iswhois.isIcelandianawiki13pp..is
paasdefpa.aswhois.asAmerican Samoaianawiki4pp..as
paasikividefpaasiki.viwhois.viVirgin Islands, U.S.ianawiki9pp..vi
paauhaudefpaauh.auwhois.auAustraliaianawiki7pp..au
paawkierdefpaawki.erwhois.erEritreaianawiki8pp..er
pabadefpa.bawhois.baBosnia and Herzegovinaianawiki4pp..ba
pabalumdefpabal.umwhois.umUnited States Minor Outlying Islandsianawiki7pp..um
pablocasalsdefpablocasa.lswhois.lsLesothoianawiki11pp..ls
pablumdefpabl.umwhois.umUnited States Minor Outlying Islandsianawiki6pp..um
pabouchdefpabou.chwhois.chSwitzerlandianawiki7pp..ch
pabstdefpab.stwhois.stSao Tome and Principeianawiki5pp..st
pabulardefpabul.arwhois.arArgentinaianawiki7pp..ar
pabulousdefpabulo.uswhois.usUnited Statesianawiki8pp..us
pabulumdefpabul.umwhois.umUnited States Minor Outlying Islandsianawiki7pp..um
pabulumsdefpabulu.mswhois.msMontserratianawiki8pp..ms
pacdefp.acwhois.acAscension Islandianawiki3pp..ac
pacadefpa.cawhois.caCanadaianawiki4pp..ca
pacanedefpaca.newhois.neNigerianawiki6pp..ne
pacaranadefpacara.nawhois.naNamibiaianawiki8pp..na
pacasdefpac.aswhois.asAmerican Samoaianawiki5pp..as
pacatelydefpacate.lywhois.lyLibyan Arab Jamahiriyaianawiki8pp..ly
pacativedefpacati.vewhois.veVenezuelaianawiki8pp..ve
paccanaristdefpaccanari.stwhois.stSao Tome and Principeianawiki11pp..st
pacchioniandefpacchioni.anwhois.anNetherlands Antillesianawiki11pp..an
pacciolidefpaccio.liwhois.liLiechtensteinianawiki8pp..li
paceeggdefpacee.ggwhois.ggGuernseyianawiki7pp..gg
pacemakedefpacema.kewhois.keKenyaianawiki8pp..ke
pacemakerdefpacemak.erwhois.erEritreaianawiki9pp..er
pacemakingdefpacemaki.ngwhois.ngNigeriaianawiki10pp..ng
pacerdefpac.erwhois.erEritreaianawiki5pp..er
pacesdefpac.eswhois.esSpainianawiki5pp..es
pacesetterdefpacesett.erwhois.erEritreaianawiki10pp..er
pacesettingdefpacesetti.ngwhois.ngNigeriaianawiki11pp..ng
pachadomdefpachad.omwhois.omOmanianawiki8pp..om
pachadomsdefpachado.mswhois.msMontserratianawiki9pp..ms
pachalicsdefpachali.cswhois.csSerbia and Montenegroianawiki9pp..cs
pachangadefpachan.gawhois.gaGabonianawiki8pp..ga
pachasdefpach.aswhois.asAmerican Samoaianawiki6pp..as
pachecodefpache.cowhois.coColombiaianawiki7pp..co
pachisidefpachi.siwhois.siSloveniaianawiki7pp..si
pachisisdefpachis.iswhois.isIcelandianawiki8pp..is
pachometerdefpachomet.erwhois.erEritreaianawiki10pp..er
pachomiandefpachomi.anwhois.anNetherlands Antillesianawiki9pp..an
pachomiusdefpachomi.uswhois.usUnited Statesianawiki9pp..us
pachoulidefpachou.liwhois.liLiechtensteinianawiki8pp..li
pachoulisdefpachoul.iswhois.isIcelandianawiki9pp..is
pachtdefpac.htwhois.htHaitiianawiki5pp..ht
pachucadefpachu.cawhois.caCanadaianawiki7pp..ca
pachucodefpachu.cowhois.coColombiaianawiki7pp..co
pachycarpousdefpachycarpo.uswhois.usUnited Statesianawiki12pp..us
pachycephaldefpachyceph.alwhois.alAlbaniaianawiki11pp..al
pachycephalousdefpachycephalo.uswhois.usUnited Statesianawiki14pp..us
pachycephalydefpachycepha.lywhois.lyLibyan Arab Jamahiriyaianawiki12pp..ly
pachycladousdefpachyclado.uswhois.usUnited Statesianawiki12pp..us
pachydactylousdefpachydactylo.uswhois.usUnited Statesianawiki14pp..us
pachydactylydefpachydacty.lywhois.lyLibyan Arab Jamahiriyaianawiki12pp..ly
pachydermadefpachyder.mawhois.maMoroccoianawiki10pp..ma
pachydermaldefpachyderm.alwhois.alAlbaniaianawiki11pp..al
pachydermateousdefpachydermateo.uswhois.usUnited Statesianawiki15pp..us
pachydermatoiddefpachydermato.idwhois.idIndonesiaianawiki14pp..id
pachydermatosisdefpachydermatos.iswhois.isIcelandianawiki15pp..is
pachydermatousdefpachydermato.uswhois.usUnited Statesianawiki14pp..us
pachydermatouslydefpachydermatous.lywhois.lyLibyan Arab Jamahiriyaianawiki16pp..ly
pachydermialdefpachydermi.alwhois.alAlbaniaianawiki12pp..al
pachydermoiddefpachydermo.idwhois.idIndonesiaianawiki12pp..id
pachydermousdefpachydermo.uswhois.usUnited Statesianawiki12pp..us
pachydermsdefpachyder.mswhois.msMontserratianawiki10pp..ms
pachyglossaldefpachygloss.alwhois.alAlbaniaianawiki12pp..al
pachyglossousdefpachyglosso.uswhois.usUnited Statesianawiki13pp..us
pachyhaemousdefpachyhaemo.uswhois.usUnited Statesianawiki12pp..us
pachyhematousdefpachyhemato.uswhois.usUnited Statesianawiki13pp..us
pachylophusdefpachyloph.uswhois.usUnited Statesianawiki11pp..us
pachylosisdefpachylos.iswhois.isIcelandianawiki10pp..is
pachymadefpachy.mawhois.maMoroccoianawiki7pp..ma
pachymeningitisdefpachymeningit.iswhois.isIcelandianawiki15pp..is
pachymeterdefpachymet.erwhois.erEritreaianawiki10pp..er
pachynathousdefpachynatho.uswhois.usUnited Statesianawiki12pp..us
pachynemadefpachyne.mawhois.maMoroccoianawiki9pp..ma
pachynsisdefpachyns.iswhois.isIcelandianawiki9pp..is
pachyotousdefpachyoto.uswhois.usUnited Statesianawiki10pp..us
pachyperitonitisdefpachyperitonit.iswhois.isIcelandianawiki16pp..is
pachyphyllousdefpachyphyllo.uswhois.usUnited Statesianawiki13pp..us
pachypodousdefpachypodo.uswhois.usUnited Statesianawiki11pp..us
pachypterousdefpachyptero.uswhois.usUnited Statesianawiki12pp..us
pachyrhizusdefpachyrhiz.uswhois.usUnited Statesianawiki11pp..us
pachyrhynchousdefpachyrhyncho.uswhois.usUnited Statesianawiki14pp..us
pachysalpingitisdefpachysalpingit.iswhois.isIcelandianawiki16pp..is
pachysandrasdefpachysandr.aswhois.asAmerican Samoaianawiki12pp..as
pachysauriandefpachysauri.anwhois.anNetherlands Antillesianawiki12pp..an
pachysomousdefpachysomo.uswhois.usUnited Statesianawiki11pp..us
pachystichousdefpachysticho.uswhois.usUnited Statesianawiki13pp..us
pachystimadefpachysti.mawhois.maMoroccoianawiki10pp..ma
pachytenedefpachyte.newhois.neNigerianawiki9pp..ne
pachytrichousdefpachytricho.uswhois.usUnited Statesianawiki13pp..us
pachytylusdefpachytyl.uswhois.usUnited Statesianawiki10pp..us
pachyvaginitisdefpachyvaginit.iswhois.isIcelandianawiki14pp..is
paciandefpaci.anwhois.anNetherlands Antillesianawiki6pp..an
pacificadefpacifi.cawhois.caCanadaianawiki8pp..ca
pacificaldefpacific.alwhois.alAlbaniaianawiki9pp..al
pacificallydefpacifical.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
pacificasdefpacific.aswhois.asAmerican Samoaianawiki9pp..as
pacificatingdefpacificati.ngwhois.ngNigeriaianawiki12pp..ng
pacifichighdefpacifichi.ghwhois.ghGhanaianawiki11pp..gh
pacificismdefpacifici.smwhois.smSan Marinoianawiki10pp..sm
pacificistdefpacifici.stwhois.stSao Tome and Principeianawiki10pp..st
pacificisticallydefpacificistical.lywhois.lyLibyan Arab Jamahiriyaianawiki16pp..ly
pacificmadronedefpacificmadro.newhois.neNigerianawiki14pp..ne
pacificnorthwestdefpacificnorthwe.stwhois.stSao Tome and Principeianawiki16pp..st
pacificodefpacifi.cowhois.coColombiaianawiki8pp..co
pacificoceandefpacificoce.anwhois.anNetherlands Antillesianawiki12pp..an
pacifierdefpacifi.erwhois.erEritreaianawiki8pp..er
pacifiesdefpacifi.eswhois.esSpainianawiki8pp..es
pacifismdefpacifi.smwhois.smSan Marinoianawiki8pp..sm
pacifismsdefpacifis.mswhois.msMontserratianawiki9pp..ms
pacifistdefpacifi.stwhois.stSao Tome and Principeianawiki8pp..st
pacifisticallydefpacifistical.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
pacifyingdefpacifyi.ngwhois.ngNigeriaianawiki9pp..ng
pacifyinglydefpacifying.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
pacingdefpaci.ngwhois.ngNigeriaianawiki6pp..ng
paciniandefpacini.anwhois.anNetherlands Antillesianawiki8pp..an
packdefpa.ckwhois.ckCook Islandsianawiki4pp..ck
packagedefpacka.gewhois.geGeorgiaianawiki7pp..ge
packageadvertisingdefpackageadvertisi.ngwhois.ngNigeriaianawiki18pp..ng
packagebargainingdefpackagebargaini.ngwhois.ngNigeriaianawiki17pp..ng
packageconveyerdefpackageconvey.erwhois.erEritreaianawiki15pp..er
packagedealdefpackagede.alwhois.alAlbaniaianawiki11pp..al
packagedhousedefpackagedhou.sewhois.seSwedenianawiki13pp..se
packagerdefpackag.erwhois.erEritreaianawiki8pp..er
packagesdefpackag.eswhois.esSpainianawiki8pp..es
packagestoredefpackagesto.rewhois.reReunion Islandianawiki12pp..re
packagingdefpackagi.ngwhois.ngNigeriaianawiki9pp..ng
packagingsdefpackagin.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki10pp..gs
packanimaldefpackanim.alwhois.alAlbaniaianawiki10pp..al
packapunchdefpackapun.chwhois.chSwitzerlandianawiki10pp..ch
packbearerdefpackbear.erwhois.erEritreaianawiki10pp..er
packbearingdefpackbeari.ngwhois.ngNigeriaianawiki11pp..ng
packbuilderdefpackbuild.erwhois.erEritreaianawiki11pp..er
packcarrierdefpackcarri.erwhois.erEritreaianawiki11pp..er
packclothdefpackclo.thwhois.thThailandianawiki9pp..th
packdriverdefpackdriv.erwhois.erEritreaianawiki10pp..er
packduckdefpackdu.ckwhois.ckCook Islandsianawiki8pp..ck
packedcaucusdefpackedcauc.uswhois.usUnited Statesianawiki12pp..us
packeddealdefpackedde.alwhois.alAlbaniaianawiki10pp..al
packedlikeherringsdefpackedlikeherrin.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki18pp..gs
packedlikesardinesdefpackedlikesardin.eswhois.esSpainianawiki18pp..es
packerdefpack.erwhois.erEritreaianawiki6pp..er
packeriesdefpackeri.eswhois.esSpainianawiki9pp..es
packetdefpack.etwhois.etEthiopiaianawiki6pp..et
packetboatdefpacketbo.atwhois.atAustriaianawiki10pp..at
packetfoliodefpacketfol.iowhois.ioBritish Indian Ocean Territoryianawiki11pp..io
packetingdefpacketi.ngwhois.ngNigeriaianawiki9pp..ng
packhoisterdefpackhoist.erwhois.erEritreaianawiki11pp..er
packhorsedefpackhor.sewhois.seSwedenianawiki9pp..se
packhorsesdefpackhors.eswhois.esSpainianawiki10pp..es
packhousedefpackhou.sewhois.seSwedenianawiki9pp..se
packindefpack.inwhois.inIndiaianawiki6pp..in
packingdefpacki.ngwhois.ngNigeriaianawiki7pp..ng
packingcasedefpackingca.sewhois.seSwedenianawiki11pp..se
packinghousedefpackinghou.sewhois.seSwedenianawiki12pp..se
packingringdefpackingri.ngwhois.ngNigeriaianawiki11pp..ng
packingsdefpackin.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki8pp..gs
packlydefpack.lywhois.lyLibyan Arab Jamahiriyaianawiki6pp..ly
packmakerdefpackmak.erwhois.erEritreaianawiki9pp..er
packmakingdefpackmaki.ngwhois.ngNigeriaianawiki10pp..ng
packmandefpackm.anwhois.anNetherlands Antillesianawiki7pp..an
packnessesdefpackness.eswhois.esSpainianawiki10pp..es
packofcigarettesdefpackofcigarett.eswhois.esSpainianawiki16pp..es
packofdogsdefpackofdo.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki10pp..gs
packofliesdefpackofli.eswhois.esSpainianawiki10pp..es
packofnonsensedefpackofnonsen.sewhois.seSwedenianawiki14pp..se
packoftroublesdefpackoftroubl.eswhois.esSpainianawiki14pp..es
packonsaildefpackonsa.ilwhois.ilIsraelianawiki10pp..il
packplanedefpackpla.newhois.neNigerianawiki9pp..ne
packpullerdefpackpull.erwhois.erEritreaianawiki10pp..er
packratdefpackr.atwhois.atAustriaianawiki7pp..at
packroaddefpackro.adwhois.adAndorraianawiki8pp..ad
packrollingdefpackrolli.ngwhois.ngNigeriaianawiki11pp..ng
packsackdefpacksa.ckwhois.ckCook Islandsianawiki8pp..ck
packsaddlesdefpacksaddl.eswhois.esSpainianawiki11pp..es
packsheetdefpackshe.etwhois.etEthiopiaianawiki9pp..et
packstavesdefpackstav.eswhois.esSpainianawiki10pp..es
packthedealdefpackthede.alwhois.alAlbaniaianawiki11pp..al
packthreaddefpackthre.adwhois.adAndorraianawiki10pp..ad
packtongdefpackto.ngwhois.ngNigeriaianawiki8pp..ng
packtraindefpacktra.inwhois.inIndiaianawiki9pp..in
packtwinedefpacktwi.newhois.neNigerianawiki9pp..ne
packwallerdefpackwall.erwhois.erEritreaianawiki10pp..er
packwaredefpackwa.rewhois.reReunion Islandianawiki8pp..re
packwaukeedefpackwauk.eewhois.eeEstoniaianawiki10pp..ee
packwaxdefpackw.axwhois.axAland Islandsianawiki7pp..ax
packwaxesdefpackwax.eswhois.esSpainianawiki9pp..es
pacodefpa.cowhois.coColombiaianawiki4pp..co
pacoimadefpacoi.mawhois.maMoroccoianawiki7pp..ma
pacoletdefpacol.etwhois.etEthiopiaianawiki7pp..et
pacorrodefpacor.rowhois.roRomaniaianawiki7pp..ro
pacouryuvadefpacouryu.vawhois.vaHoly See (Vatican City State)ianawiki10pp..va
pacquetdefpacqu.etwhois.etEthiopiaianawiki7pp..et
pacsdefpa.cswhois.csSerbia and Montenegroianawiki4pp..cs
pactionaldefpaction.alwhois.alAlbaniaianawiki9pp..al
pactionallydefpactional.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
pactoliandefpactoli.anwhois.anNetherlands Antillesianawiki9pp..an
pactolusdefpactol.uswhois.usUnited Statesianawiki8pp..us
pactumdefpact.umwhois.umUnited States Minor Outlying Islandsianawiki6pp..um
pacudefpa.cuwhois.cuCubaianawiki4pp..cu
pacxdefpa.cxwhois.cxChristmas Islandianawiki4pp..cx
paddefp.adwhois.adAndorraianawiki3pp..ad
padangdefpada.ngwhois.ngNigeriaianawiki6pp..ng
padaukdefpada.ukwhois.ukUnited Kingdomianawiki6pp..uk
padclothdefpadclo.thwhois.thThailandianawiki8pp..th
padcluothdefpadcluo.thwhois.thThailandianawiki9pp..th
padcrimpdefpadcri.mpwhois.mpNorthern Mariana Islandsianawiki8pp..mp
padderdefpadd.erwhois.erEritreaianawiki6pp..er
paddiedefpadd.iewhois.ieIrelandianawiki6pp..ie
paddiesdefpaddi.eswhois.esSpainianawiki7pp..es
paddingdefpaddi.ngwhois.ngNigeriaianawiki7pp..ng
paddingsdefpaddin.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki8pp..gs
paddlebeamdefpaddlebe.amwhois.amArmeniaianawiki10pp..am
paddleboatdefpaddlebo.atwhois.atAustriaianawiki10pp..at
paddlecockdefpaddleco.ckwhois.ckCook Islandsianawiki10pp..ck
paddlefishdefpaddlefi.shwhois.shSaint Helenaianawiki10pp..sh
paddlefishesdefpaddlefish.eswhois.esSpainianawiki12pp..es
paddlelikedefpaddleli.kewhois.keKenyaianawiki10pp..ke
paddlerdefpaddl.erwhois.erEritreaianawiki7pp..er
paddlesdefpaddl.eswhois.esSpainianawiki7pp..es
paddlesteamerdefpaddlesteam.erwhois.erEritreaianawiki13pp..er
paddletennisdefpaddletenn.iswhois.isIcelandianawiki12pp..is
paddletumblerdefpaddletumbl.erwhois.erEritreaianawiki13pp..er
paddlewingdefpaddlewi.ngwhois.ngNigeriaianawiki10pp..ng
paddlingdefpaddli.ngwhois.ngNigeriaianawiki8pp..ng
paddlingsdefpaddlin.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki9pp..gs
paddockdefpaddo.ckwhois.ckCook Islandsianawiki7pp..ck
paddockingdefpaddocki.ngwhois.ngNigeriaianawiki10pp..ng
paddockpipedefpaddockpi.pewhois.pePeruianawiki11pp..pe
paddockridedefpaddockri.dewhois.deGermanyianawiki11pp..de
paddockstonedefpaddocksto.newhois.neNigerianawiki12pp..ne
paddoingdefpaddoi.ngwhois.ngNigeriaianawiki8pp..ng
paddyblastdefpaddybla.stwhois.stSao Tome and Principeianawiki10pp..st
paddyismdefpaddyi.smwhois.smSan Marinoianawiki8pp..sm
paddywackdefpaddywa.ckwhois.ckCook Islandsianawiki9pp..ck
paddywatchdefpaddywat.chwhois.chSwitzerlandianawiki10pp..ch
paddywhackdefpaddywha.ckwhois.ckCook Islandsianawiki10pp..ck
paddywhackalmanacdefpaddywhackalman.acwhois.acAscension Islandianawiki17pp..ac
padegsdefpade.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki6pp..gs
padelladefpadel.lawhois.laLao People's Democratic Republicianawiki7pp..la
paderewskidefpaderews.kiwhois.kiKiribatiianawiki10pp..ki
padernadefpader.nawhois.naNamibiaianawiki7pp..na
padeyedefpade.yewhois.yeYemenianawiki6pp..ye
padeyesdefpadey.eswhois.esSpainianawiki7pp..es
padgedefpad.gewhois.geGeorgiaianawiki5pp..ge
padgetdefpadg.etwhois.etEthiopiaianawiki6pp..et
padgettdefpadge.ttwhois.ttTrinidad and Tobagoianawiki7pp..tt
padgroomdefpadgro.omwhois.omOmanianawiki8pp..om
padhorsedefpadhor.sewhois.seSwedenianawiki8pp..se
padigedefpadi.gewhois.geGeorgiaianawiki6pp..ge
padinadefpadi.nawhois.naNamibiaianawiki6pp..na
padisdefpad.iswhois.isIcelandianawiki5pp..is
padlesdefpadl.eswhois.esSpainianawiki6pp..es
padlikedefpadli.kewhois.keKenyaianawiki7pp..ke
padlockdefpadlo.ckwhois.ckCook Islandsianawiki7pp..ck
padlockingdefpadlocki.ngwhois.ngNigeriaianawiki10pp..ng
padlocklawdefpadlockl.awwhois.awArubaianawiki10pp..aw
padmasanadefpadmasa.nawhois.naNamibiaianawiki9pp..na
padnagdefpadn.agwhois.agAntigua and Barbudaianawiki6pp..ag
padnagsdefpadna.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki7pp..gs
padoukdefpado.ukwhois.ukUnited Kingdomianawiki6pp..uk
padovadefpado.vawhois.vaHoly See (Vatican City State)ianawiki6pp..va
padparadschahsapphiredefpadparadschahsapphi.rewhois.reReunion Islandianawiki21pp..re
padredefpad.rewhois.reReunion Islandianawiki5pp..re
padresdefpadr.eswhois.esSpainianawiki6pp..es
padriacdefpadri.acwhois.acAscension Islandianawiki7pp..ac
padrinodefpadri.nowhois.noNorwayianawiki7pp..no
padroadistdefpadroadi.stwhois.stSao Tome and Principeianawiki10pp..st
padroadodefpadroa.dowhois.doDominican Republicianawiki8pp..do
padronadefpadro.nawhois.naNamibiaianawiki7pp..na
padronedefpadro.newhois.neNigerianawiki7pp..ne
padronesdefpadron.eswhois.esSpainianawiki8pp..es
padronidefpadro.niwhois.niNicaraguaianawiki7pp..ni
padronismdefpadroni.smwhois.smSan Marinoianawiki9pp..sm
padsawdefpads.awwhois.awArubaianawiki6pp..aw
padstonedefpadsto.newhois.neNigerianawiki8pp..ne
padtreedefpadtr.eewhois.eeEstoniaianawiki7pp..ee
paduadefpad.uawhois.uaUkraineianawiki5pp..ua
paduandefpadu.anwhois.anNetherlands Antillesianawiki6pp..an
paduanismdefpaduani.smwhois.smSan Marinoianawiki9pp..sm
padusdefpad.uswhois.usUnited Statesianawiki5pp..us
paeandefpae.anwhois.anNetherlands Antillesianawiki5pp..an
paeanismdefpaeani.smwhois.smSan Marinoianawiki8pp..sm
paeanismsdefpaeanis.mswhois.msMontserratianawiki9pp..ms
paeanizingdefpaeanizi.ngwhois.ngNigeriaianawiki10pp..ng
paedagogismdefpaedagogi.smwhois.smSan Marinoianawiki11pp..sm
paedagogydefpaedago.gywhois.gyGuyanaianawiki9pp..gy
paederastdefpaedera.stwhois.stSao Tome and Principeianawiki9pp..st
paederasticallydefpaederastical.lywhois.lyLibyan Arab Jamahiriyaianawiki15pp..ly
paedeuticsdefpaedeuti.cswhois.csSerbia and Montenegroianawiki10pp..cs
paediatriciandefpaediatrici.anwhois.anNetherlands Antillesianawiki13pp..an
paediatricsdefpaediatri.cswhois.csSerbia and Montenegroianawiki11pp..cs
paedodefpae.dowhois.doDominican Republicianawiki5pp..do
paedobaptismdefpaedobapti.smwhois.smSan Marinoianawiki12pp..sm
paedobaptistdefpaedobapti.stwhois.stSao Tome and Principeianawiki12pp..st
paedogenesisdefpaedogenes.iswhois.isIcelandianawiki12pp..is
paedologicaldefpaedologic.alwhois.alAlbaniaianawiki12pp..al
paedologistdefpaedologi.stwhois.stSao Tome and Principeianawiki11pp..st
paedologydefpaedolo.gywhois.gyGuyanaianawiki9pp..gy
paedometerdefpaedomet.erwhois.erEritreaianawiki10pp..er
paedometricaldefpaedometric.alwhois.alAlbaniaianawiki13pp..al
paedomorphismdefpaedomorphi.smwhois.smSan Marinoianawiki13pp..sm
paedomorphosisdefpaedomorphos.iswhois.isIcelandianawiki14pp..is
paedonymydefpaedony.mywhois.myMalaysiaianawiki9pp..my
paedopsychologistdefpaedopsychologi.stwhois.stSao Tome and Principeianawiki17pp..st
paedotribedefpaedotri.bewhois.beBelgiumianawiki10pp..be
paedotrophistdefpaedotrophi.stwhois.stSao Tome and Principeianawiki13pp..st
paeligniandefpaeligni.anwhois.anNetherlands Antillesianawiki10pp..an
paelladefpael.lawhois.laLao People's Democratic Republicianawiki6pp..la
paellasdefpaell.aswhois.asAmerican Samoaianawiki7pp..as
paenuladefpaenu.lawhois.laLao People's Democratic Republicianawiki7pp..la
paenulaedefpaenul.aewhois.aeUnited Arab Emiratesianawiki8pp..ae
paenulasdefpaenul.aswhois.asAmerican Samoaianawiki8pp..as
paeoniaceaedefpaeoniace.aewhois.aeUnited Arab Emiratesianawiki11pp..ae
paeoniandefpaeoni.anwhois.anNetherlands Antillesianawiki8pp..an
paeonindefpaeon.inwhois.inIndiaianawiki7pp..in
paeounlaedefpaeounl.aewhois.aeUnited Arab Emiratesianawiki9pp..ae
paepaedefpaep.aewhois.aeUnited Arab Emiratesianawiki6pp..ae
paesandefpaes.anwhois.anNetherlands Antillesianawiki6pp..an
paesanidefpaesa.niwhois.niNicaraguaianawiki7pp..ni
paesanodefpaesa.nowhois.noNorwayianawiki7pp..no
paestumdefpaest.umwhois.umUnited States Minor Outlying Islandsianawiki7pp..um
paetrickdefpaetri.ckwhois.ckCook Islandsianawiki8pp..ck
pagdefp.agwhois.agAntigua and Barbudaianawiki3pp..ag
pagadefpa.gawhois.gaGabonianawiki4pp..ga
pagandefpag.anwhois.anNetherlands Antillesianawiki5pp..an
paganaliandefpaganali.anwhois.anNetherlands Antillesianawiki10pp..an
pagandomdefpagand.omwhois.omOmanianawiki8pp..om
pagandomsdefpagando.mswhois.msMontserratianawiki9pp..ms
paganicaldefpaganic.alwhois.alAlbaniaianawiki9pp..al
paganicallydefpaganical.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
paganinidefpagani.niwhois.niNicaraguaianawiki8pp..ni
paganisedefpagani.sewhois.seSwedenianawiki8pp..se
paganiserdefpaganis.erwhois.erEritreaianawiki9pp..er
paganisesdefpaganis.eswhois.esSpainianawiki9pp..es
paganishdefpagani.shwhois.shSaint Helenaianawiki8pp..sh
paganishlydefpaganish.lywhois.lyLibyan Arab Jamahiriyaianawiki10pp..ly
paganisingdefpaganisi.ngwhois.ngNigeriaianawiki10pp..ng
paganismdefpagani.smwhois.smSan Marinoianawiki8pp..sm
paganismsdefpaganis.mswhois.msMontserratianawiki9pp..ms
paganistdefpagani.stwhois.stSao Tome and Principeianawiki8pp..st
paganizerdefpaganiz.erwhois.erEritreaianawiki9pp..er
paganizesdefpaganiz.eswhois.esSpainianawiki9pp..es
paganizingdefpaganizi.ngwhois.ngNigeriaianawiki10pp..ng
paganlydefpagan.lywhois.lyLibyan Arab Jamahiriyaianawiki7pp..ly
paganochristiandefpaganochristi.anwhois.anNetherlands Antillesianawiki15pp..an
paganochristianismdefpaganochristiani.smwhois.smSan Marinoianawiki18pp..sm
paganpriestdefpaganprie.stwhois.stSao Tome and Principeianawiki11pp..st
pagasdefpag.aswhois.asAmerican Samoaianawiki5pp..as
pagatpatdefpagatp.atwhois.atAustriaianawiki8pp..at
pagedefpa.gewhois.geGeorgiaianawiki4pp..ge
pageanteerdefpageante.erwhois.erEritreaianawiki10pp..er
pageantriesdefpageantri.eswhois.esSpainianawiki11pp..es
pagechairdefpagecha.irwhois.irIran, Islamic Republic ofianawiki9pp..ir
pagedomdefpaged.omwhois.omOmanianawiki7pp..om
pagegaugedefpagegau.gewhois.geGeorgiaianawiki9pp..ge
pagelikedefpageli.kewhois.keKenyaianawiki8pp..ke
pagenumberingdefpagenumberi.ngwhois.ngNigeriaianawiki13pp..ng
pagerdefpag.erwhois.erEritreaianawiki5pp..er
pagerestdefpagere.stwhois.stSao Tome and Principeianawiki8pp..st
pagesdefpag.eswhois.esSpainianawiki5pp..es
pagetdefpag.etwhois.etEthiopiaianawiki5pp..et
pagethroughdefpagethrou.ghwhois.ghGhanaianawiki11pp..gh
pagetscancerdefpagetscanc.erwhois.erEritreaianawiki12pp..er
pagetsdiseasedefpagetsdisea.sewhois.seSwedenianawiki13pp..se
paginadefpagi.nawhois.naNamibiaianawiki6pp..na
paginaedefpagin.aewhois.aeUnited Arab Emiratesianawiki7pp..ae
paginaldefpagin.alwhois.alAlbaniaianawiki7pp..al
paginatesdefpaginat.eswhois.esSpainianawiki9pp..es
paginatingdefpaginati.ngwhois.ngNigeriaianawiki10pp..ng
paginedefpagi.newhois.neNigerianawiki6pp..ne
pagingdefpagi.ngwhois.ngNigeriaianawiki6pp..ng
pagingsdefpagin.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki7pp..gs
pagnedefpag.newhois.neNigerianawiki5pp..ne
pagnesdefpagn.eswhois.esSpainianawiki6pp..es
pagodalikedefpagodali.kewhois.keKenyaianawiki10pp..ke
pagodasdefpagod.aswhois.asAmerican Samoaianawiki7pp..as
pagodasleevedefpagodaslee.vewhois.veVenezuelaianawiki12pp..ve
pagodastonedefpagodasto.newhois.neNigerianawiki11pp..ne
pagodatreedefpagodatr.eewhois.eeEstoniaianawiki10pp..ee
pagoscopedefpagosco.pewhois.pePeruianawiki9pp..pe
pagrusdefpagr.uswhois.usUnited Statesianawiki6pp..us
pagumadefpagu.mawhois.maMoroccoianawiki6pp..ma
paguriandefpaguri.anwhois.anNetherlands Antillesianawiki8pp..an
paguriddefpagur.idwhois.idIndonesiaianawiki7pp..id
paguridaedefpagurid.aewhois.aeUnited Arab Emiratesianawiki9pp..ae
pagurinedefpaguri.newhois.neNigerianawiki8pp..ne
paguroiddefpaguro.idwhois.idIndonesiaianawiki8pp..id
pagurusdefpagur.uswhois.usUnited Statesianawiki7pp..us
pagusdefpag.uswhois.usUnited Statesianawiki5pp..us
pahachromadefpahachro.mawhois.maMoroccoianawiki10pp..ma
pahaladefpaha.lawhois.laLao People's Democratic Republicianawiki6pp..la
pahangdefpaha.ngwhois.ngNigeriaianawiki6pp..ng
paharisdefpahar.iswhois.isIcelandianawiki7pp..is
pahlavidefpahla.viwhois.viVirgin Islands, U.S.ianawiki7pp..vi
pahlavisdefpahlav.iswhois.isIcelandianawiki8pp..is
pahlevidefpahle.viwhois.viVirgin Islands, U.S.ianawiki7pp..vi
pahokeedefpahok.eewhois.eeEstoniaianawiki7pp..ee
pahouindefpahou.inwhois.inIndiaianawiki7pp..in
pahrumpdefpahru.mpwhois.mpNorthern Mariana Islandsianawiki7pp..mp
pahutandefpahut.anwhois.anNetherlands Antillesianawiki7pp..an
paicinesdefpaicin.eswhois.esSpainianawiki8pp..es
paiconecadefpaicone.cawhois.caCanadaianawiki9pp..ca
paiddefpa.idwhois.idIndonesiaianawiki4pp..id
paideuticsdefpaideuti.cswhois.csSerbia and Montenegroianawiki10pp..cs
paidindefpaid.inwhois.inIndiaianawiki6pp..in
paidologicaldefpaidologic.alwhois.alAlbaniaianawiki12pp..al
paidologistdefpaidologi.stwhois.stSao Tome and Principeianawiki11pp..st
paidologydefpaidolo.gywhois.gyGuyanaianawiki9pp..gy
paidonosologydefpaidonosolo.gywhois.gyGuyanaianawiki13pp..gy
paigedefpai.gewhois.geGeorgiaianawiki5pp..ge
paihuadefpaih.uawhois.uaUkraineianawiki6pp..ua
paijamadefpaija.mawhois.maMoroccoianawiki7pp..ma
paikerdefpaik.erwhois.erEritreaianawiki6pp..er
paikingdefpaiki.ngwhois.ngNigeriaianawiki7pp..ng
paildefpa.ilwhois.ilIsraelianawiki4pp..il
pailfulsdefpailfu.lswhois.lsLesothoianawiki8pp..ls
paillassedefpaillas.sewhois.seSwedenianawiki9pp..se
paillefinnedefpaillefin.newhois.neNigerianawiki11pp..ne
paillesdefpaill.eswhois.esSpainianawiki7pp..es
paillettesdefpaillett.eswhois.esSpainianawiki10pp..es
pailsdefpai.lswhois.lsLesothoianawiki5pp..ls
paimanehdefpaiman.ehwhois.ehWestern Saharaianawiki8pp..eh
paindefpa.inwhois.inIndiaianawiki4pp..in
painassuagingdefpainassuagi.ngwhois.ngNigeriaianawiki13pp..ng
painbearingdefpainbeari.ngwhois.ngNigeriaianawiki11pp..ng
painboughtdefpainboug.htwhois.htHaitiianawiki10pp..ht
painchdefpain.chwhois.chSwitzerlandianawiki6pp..ch
painchesdefpainch.eswhois.esSpainianawiki8pp..es
paindemainedefpaindemai.newhois.neNigerianawiki11pp..ne
paindispellingdefpaindispelli.ngwhois.ngNigeriaianawiki14pp..ng
painedefpai.newhois.neNigerianawiki5pp..ne
painfearingdefpainfeari.ngwhois.ngNigeriaianawiki11pp..ng
painfreedefpainfr.eewhois.eeEstoniaianawiki8pp..ee
painfullerdefpainfull.erwhois.erEritreaianawiki10pp..er
painfullestdefpainfulle.stwhois.stSao Tome and Principeianawiki11pp..st
painfullydefpainful.lywhois.lyLibyan Arab Jamahiriyaianawiki9pp..ly
paingivingdefpaingivi.ngwhois.ngNigeriaianawiki10pp..ng
paininflictingdefpaininflicti.ngwhois.ngNigeriaianawiki14pp..ng
painingdefpaini.ngwhois.ngNigeriaianawiki7pp..ng
paininglydefpaining.lywhois.lyLibyan Arab Jamahiriyaianawiki9pp..ly
painintheneckdefpaininthene.ckwhois.ckCook Islandsianawiki13pp..ck
painkillerdefpainkill.erwhois.erEritreaianawiki10pp..er
painkillingdefpainkilli.ngwhois.ngNigeriaianawiki11pp..ng
painlesslydefpainless.lywhois.lyLibyan Arab Jamahiriyaianawiki10pp..ly
painproducingdefpainproduci.ngwhois.ngNigeriaianawiki13pp..ng
painstakerdefpainstak.erwhois.erEritreaianawiki10pp..er
painstakingdefpainstaki.ngwhois.ngNigeriaianawiki11pp..ng
painstakinglydefpainstaking.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
painstakinglymatchdefpainstakinglymat.chwhois.chSwitzerlandianawiki18pp..ch
paintdefpa.intwhois.intInternational Organizationsianawiki5pp..int
paintablydefpaintab.lywhois.lyLibyan Arab Jamahiriyaianawiki9pp..ly
paintapicturedefpaintapictu.rewhois.reReunion Islandianawiki13pp..re
paintbinderdefpaintbind.erwhois.erEritreaianawiki11pp..er
paintbridgedefpaintbrid.gewhois.geGeorgiaianawiki11pp..ge
paintbrushdefpaintbru.shwhois.shSaint Helenaianawiki10pp..sh
paintbrusherdefpaintbrush.erwhois.erEritreaianawiki12pp..er
paintbrushesdefpaintbrush.eswhois.esSpainianawiki12pp..es
paintcleanerdefpaintclean.erwhois.erEritreaianawiki12pp..er
paintdrierdefpaintdri.erwhois.erEritreaianawiki10pp..er
paintedbuntingdefpaintedbunti.ngwhois.ngNigeriaianawiki14pp..ng
paintedgreenlingdefpaintedgreenli.ngwhois.ngNigeriaianawiki16pp..ng
paintedpostdefpainted.postwhois.postPostalN/Awiki11pp..post
paintedpostdefpaintedpo.stwhois.stSao Tome and Principeianawiki11pp..st
paintedsnipedefpaintedsni.pewhois.pePeruianawiki12pp..pe
paintedtrilliumdefpaintedtrilli.umwhois.umUnited States Minor Outlying Islandsianawiki15pp..um
paintedwomandefpaintedwom.anwhois.anNetherlands Antillesianawiki12pp..an
painterdefpaint.erwhois.erEritreaianawiki7pp..er
painteretcherdefpainteretch.erwhois.erEritreaianawiki13pp..er
painteretchingdefpainteretchi.ngwhois.ngNigeriaianawiki14pp..ng
paintergraverdefpaintergrav.erwhois.erEritreaianawiki13pp..er
paintergravingdefpaintergravi.ngwhois.ngNigeriaianawiki14pp..ng
painterishdefpainteri.shwhois.shSaint Helenaianawiki10pp..sh
painterlikedefpainterli.kewhois.keKenyaianawiki11pp..ke
painterlydefpainter.lywhois.lyLibyan Arab Jamahiriyaianawiki9pp..ly
painterscreamdefpainterscre.amwhois.amArmeniaianawiki13pp..am
painterstainerdefpainterstain.erwhois.erEritreaianawiki14pp..er
paintfillerdefpaintfill.erwhois.erEritreaianawiki11pp..er
paintfillingdefpaintfilli.ngwhois.ngNigeriaianawiki12pp..ng
paintfinishdefpaintfini.shwhois.shSaint Helenaianawiki11pp..sh
paintgrinderdefpaintgrind.erwhois.erEritreaianawiki12pp..er
painthorsedefpainthor.sewhois.seSwedenianawiki10pp..se
painthosedefpaintho.sewhois.seSwedenianawiki9pp..se
paintierdefpainti.erwhois.erEritreaianawiki8pp..er
paintiestdefpaintie.stwhois.stSao Tome and Principeianawiki9pp..st
paintingdefpainti.ngwhois.ngNigeriaianawiki8pp..ng
paintingsdefpaintin.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki9pp..gs
paintingwiththegiftofspeechdefpaintingwiththegiftofspee.chwhois.chSwitzerlandianawiki27pp..ch
paintkegdefpaintk.egwhois.egEgyptianawiki8pp..eg
paintlickdefpaintli.ckwhois.ckCook Islandsianawiki9pp..ck
paintlockerdefpaintlock.erwhois.erEritreaianawiki11pp..er
paintmixerdefpaintmix.erwhois.erEritreaianawiki10pp..er
paintmixingdefpaintmixi.ngwhois.ngNigeriaianawiki11pp..ng
paintprimerdefpaintprim.erwhois.erEritreaianawiki11pp..er
paintremoverdefpaintremov.erwhois.erEritreaianawiki12pp..er
paintremovingdefpaintremovi.ngwhois.ngNigeriaianawiki13pp..ng
paintrollerdefpaintroll.erwhois.erEritreaianawiki11pp..er
paintroomdefpaintro.omwhois.omOmanianawiki9pp..om
paintrootdefpaint.rootwhois.rootRoot Server InfrastructureN/Awiki9pp..root
paintsprayingdefpaintsprayi.ngwhois.ngNigeriaianawiki13pp..ng
paintstrakedefpaintstra.kewhois.keKenyaianawiki11pp..ke
paintthelilydefpainttheli.lywhois.lyLibyan Arab Jamahiriyaianawiki12pp..ly
paintthinnerdefpaintthinn.erwhois.erEritreaianawiki12pp..er
painturedefpaintu.rewhois.reReunion Islandianawiki8pp..re
paintwashingdefpaintwashi.ngwhois.ngNigeriaianawiki12pp..ng
paintyourselfintoacornerdefpaintyourselfintoacorn.erwhois.erEritreaianawiki24pp..er
painwroughtdefpainwroug.htwhois.htHaitiianawiki11pp..ht
painwrungdefpainwru.ngwhois.ngNigeriaianawiki9pp..ng
paiockdefpaio.ckwhois.ckCook Islandsianawiki6pp..ck
paiockedefpaioc.kewhois.keKenyaianawiki7pp..ke
pairdefpa.irwhois.irIran, Islamic Republic ofianawiki4pp..ir
paircasedefpairca.sewhois.seSwedenianawiki8pp..se
pairedwithdefpairedwi.thwhois.thThailandianawiki10pp..th
pairerdefpair.erwhois.erEritreaianawiki6pp..er
pairhorsedefpairhor.sewhois.seSwedenianawiki9pp..se
pairialdefpairi.alwhois.alAlbaniaianawiki7pp..al
pairingdefpairi.ngwhois.ngNigeriaianawiki7pp..ng
pairingsdefpairin.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki8pp..gs
pairoardefpairo.arwhois.arArgentinaianawiki7pp..ar
pairofbellowsdefpairofbello.wswhois.wsWestern Samoaianawiki13pp..ws
pairofcompassesdefpairofcompass.eswhois.esSpainianawiki15pp..es
pairofglassesdefpairofglass.eswhois.esSpainianawiki13pp..es
pairofscalesdefpairofscal.eswhois.esSpainianawiki12pp..es
pairofspectaclesdefpairofspectacl.eswhois.esSpainianawiki16pp..es
pairoftongsdefpairofton.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki11pp..gs
pairofvirginalsdefpairofvirgina.lswhois.lsLesothoianawiki15pp..ls
pairroyaldefpairroy.alwhois.alAlbaniaianawiki9pp..al
pairwisedefpairwi.sewhois.seSwedenianawiki8pp..se
paisdefpa.iswhois.isIcelandianawiki4pp..is
paisadefpai.sawhois.saSaudi Arabiaianawiki5pp..sa
paisandefpais.anwhois.anNetherlands Antillesianawiki6pp..an
paisanadefpaisa.nawhois.naNamibiaianawiki7pp..na
paisanasdefpaisan.aswhois.asAmerican Samoaianawiki8pp..as
paisanodefpaisa.nowhois.noNorwayianawiki7pp..no
paisasdefpais.aswhois.asAmerican Samoaianawiki6pp..as
paisedefpai.sewhois.seSwedenianawiki5pp..se
paisleyprintdefpaisleypr.intwhois.intInternational Organizationsianawiki12pp..int
paizingdefpaizi.ngwhois.ngNigeriaianawiki7pp..ng
pajamadefpaja.mawhois.maMoroccoianawiki6pp..ma
pajamasdefpajam.aswhois.asAmerican Samoaianawiki7pp..as
pajerodefpaje.rowhois.roRomaniaianawiki6pp..ro
pajockdefpajo.ckwhois.ckCook Islandsianawiki6pp..ck
pajonismdefpajoni.smwhois.smSan Marinoianawiki8pp..sm
pakanbarudefpakanba.ruwhois.ruRussian Federationianawiki9pp..ru
pakawandefpakaw.anwhois.anNetherlands Antillesianawiki7pp..an
pakchoicabbagedefpakchoicabba.gewhois.geGeorgiaianawiki14pp..ge
pakchoisdefpakcho.iswhois.isIcelandianawiki8pp..is
pakhpulukdefpakhpul.ukwhois.ukUnited Kingdomianawiki9pp..uk
pakidefpa.kiwhois.kiKiribatiianawiki4pp..ki
pakibashingdefpakibashi.ngwhois.ngNigeriaianawiki11pp..ng
pakistandefpakist.anwhois.anNetherlands Antillesianawiki8pp..an
pakistanidefpakista.niwhois.niNicaraguaianawiki9pp..ni
pakistanisdefpakistan.iswhois.isIcelandianawiki10pp..is
pakpaklauindefpakpaklau.inwhois.inIndiaianawiki11pp..in
paksedefpak.sewhois.seSwedenianawiki5pp..se
paktongdefpakto.ngwhois.ngNigeriaianawiki7pp..ng
paldefp.alwhois.alAlbaniaianawiki3pp..al
paladefpa.lawhois.laLao People's Democratic Republicianawiki4pp..la
palabrasdefpalabr.aswhois.asAmerican Samoaianawiki8pp..as
palacecardefpalacec.arwhois.arArgentinaianawiki9pp..ar
palacelikedefpalaceli.kewhois.keKenyaianawiki10pp..ke
palaceousdefpalaceo.uswhois.usUnited Statesianawiki9pp..us
palacesdefpalac.eswhois.esSpainianawiki7pp..es
palachdefpala.chwhois.chSwitzerlandianawiki6pp..ch
paladindefpalad.inwhois.inIndiaianawiki7pp..in
paladrudefpalad.ruwhois.ruRussian Federationianawiki7pp..ru
palaealpinedefpalaealpi.newhois.neNigerianawiki11pp..ne
palaeechinidefpalaeechi.niwhois.niNicaraguaianawiki11pp..ni
palaeechinoiddefpalaeechino.idwhois.idIndonesiaianawiki13pp..id
palaeechinoideandefpalaeechinoide.anwhois.anNetherlands Antillesianawiki16pp..an
palaeentomologydefpalaeentomolo.gywhois.gyGuyanaianawiki15pp..gy
palaeethnologicaldefpalaeethnologic.alwhois.alAlbaniaianawiki17pp..al
palaeethnologistdefpalaeethnologi.stwhois.stSao Tome and Principeianawiki16pp..st
palaeethnologydefpalaeethnolo.gywhois.gyGuyanaianawiki14pp..gy
palaeeudyptesdefpalaeeudypt.eswhois.esSpainianawiki13pp..es
palaeichthyandefpalaeichthy.anwhois.anNetherlands Antillesianawiki13pp..an
palaeichthyesdefpalaeichthy.eswhois.esSpainianawiki13pp..es
palaemoniddefpalaemon.idwhois.idIndonesiaianawiki10pp..id
palaemonidaedefpalaemonid.aewhois.aeUnited Arab Emiratesianawiki12pp..ae
palaemonoiddefpalaemono.idwhois.idIndonesiaianawiki11pp..id
palaeoalchemicaldefpalaeoalchemic.alwhois.alAlbaniaianawiki16pp..al
palaeoamericandefpalaeoameric.anwhois.anNetherlands Antillesianawiki14pp..an
palaeoanthropologydefpalaeoanthropolo.gywhois.gyGuyanaianawiki18pp..gy
palaeoanthropusdefpalaeoanthrop.uswhois.usUnited Statesianawiki15pp..us
palaeoatavismdefpalaeoatavi.smwhois.smSan Marinoianawiki13pp..sm
palaeobiologicaldefpalaeobiologic.alwhois.alAlbaniaianawiki16pp..al
palaeobiologistdefpalaeobiologi.stwhois.stSao Tome and Principeianawiki15pp..st
palaeobiologydefpalaeobiolo.gywhois.gyGuyanaianawiki13pp..gy
palaeobotanicaldefpalaeobotanic.alwhois.alAlbaniaianawiki15pp..al
palaeobotanicallydefpalaeobotanical.lywhois.lyLibyan Arab Jamahiriyaianawiki17pp..ly
palaeobotanistdefpalaeobotani.stwhois.stSao Tome and Principeianawiki14pp..st
palaeocenedefpalaeoce.newhois.neNigerianawiki10pp..ne
palaeochorologydefpalaeochorolo.gywhois.gyGuyanaianawiki15pp..gy
palaeochristiandefpalaeochristi.anwhois.anNetherlands Antillesianawiki15pp..an
palaeoclimatologicaldefpalaeoclimatologic.alwhois.alAlbaniaianawiki20pp..al
palaeoclimatologistdefpalaeoclimatologi.stwhois.stSao Tome and Principeianawiki19pp..st
palaeoclimatologydefpalaeoclimatolo.gywhois.gyGuyanaianawiki17pp..gy
palaeocosmologydefpalaeocosmolo.gywhois.gyGuyanaianawiki15pp..gy
palaeocrystaldefpalaeocryst.alwhois.alAlbaniaianawiki13pp..al
palaeocrystallinedefpalaeocrystalli.newhois.neNigerianawiki17pp..ne
palaeodendrologicaldefpalaeodendrologic.alwhois.alAlbaniaianawiki19pp..al
palaeodendrologicallydefpalaeodendrological.lywhois.lyLibyan Arab Jamahiriyaianawiki21pp..ly
palaeodendrologistdefpalaeodendrologi.stwhois.stSao Tome and Principeianawiki18pp..st
palaeodendrologydefpalaeodendrolo.gywhois.gyGuyanaianawiki16pp..gy
palaeodictyopterandefpalaeodictyopter.anwhois.anNetherlands Antillesianawiki18pp..an
palaeodictyopterousdefpalaeodictyoptero.uswhois.usUnited Statesianawiki19pp..us
palaeoecologicaldefpalaeoecologic.alwhois.alAlbaniaianawiki16pp..al
palaeoecologistdefpalaeoecologi.stwhois.stSao Tome and Principeianawiki15pp..st
palaeoecologydefpalaeoecolo.gywhois.gyGuyanaianawiki13pp..gy
palaeoencephaladefpalaeoencepha.lawhois.laLao People's Democratic Republicianawiki15pp..la
palaeoentomologicaldefpalaeoentomologic.alwhois.alAlbaniaianawiki19pp..al
palaeoentomologistdefpalaeoentomologi.stwhois.stSao Tome and Principeianawiki18pp..st
palaeoentomologydefpalaeoentomolo.gywhois.gyGuyanaianawiki16pp..gy
palaeoeremologydefpalaeoeremolo.gywhois.gyGuyanaianawiki15pp..gy
palaeoethnologicaldefpalaeoethnologic.alwhois.alAlbaniaianawiki18pp..al
palaeoethnologistdefpalaeoethnologi.stwhois.stSao Tome and Principeianawiki17pp..st
palaeoethnologydefpalaeoethnolo.gywhois.gyGuyanaianawiki15pp..gy
palaeofaunadefpalaeofau.nawhois.naNamibiaianawiki11pp..na
palaeogaeandefpalaeogae.anwhois.anNetherlands Antillesianawiki11pp..an
palaeogenedefpalaeoge.newhois.neNigerianawiki10pp..ne
palaeogenesisdefpalaeogenes.iswhois.isIcelandianawiki13pp..is
palaeogeographicaldefpalaeogeographic.alwhois.alAlbaniaianawiki18pp..al
palaeogeographicallydefpalaeogeographical.lywhois.lyLibyan Arab Jamahiriyaianawiki20pp..ly
palaeoglaciologydefpalaeoglaciolo.gywhois.gyGuyanaianawiki16pp..gy
palaeoglyphdefpalaeogly.phwhois.phPhilippinesianawiki11pp..ph
palaeognathaedefpalaeognath.aewhois.aeUnited Arab Emiratesianawiki13pp..ae
palaeognathousdefpalaeognatho.uswhois.usUnited Statesianawiki14pp..us
palaeographdefpalaeogra.phwhois.phPhilippinesianawiki11pp..ph
palaeographerdefpalaeograph.erwhois.erEritreaianawiki13pp..er
palaeographicaldefpalaeographic.alwhois.alAlbaniaianawiki15pp..al
palaeographicallydefpalaeographical.lywhois.lyLibyan Arab Jamahiriyaianawiki17pp..ly
palaeographistdefpalaeographi.stwhois.stSao Tome and Principeianawiki14pp..st
palaeoherpetologistdefpalaeoherpetologi.stwhois.stSao Tome and Principeianawiki19pp..st
palaeoherpetologydefpalaeoherpetolo.gywhois.gyGuyanaianawiki17pp..gy
palaeohistologydefpalaeohistolo.gywhois.gyGuyanaianawiki15pp..gy
palaeolimnologydefpalaeolimnolo.gywhois.gyGuyanaianawiki15pp..gy
palaeolithdefpalaeoli.thwhois.thThailandianawiki10pp..th
palaeolithicaldefpalaeolithic.alwhois.alAlbaniaianawiki14pp..al
palaeolithicmandefpalaeolithicm.anwhois.anNetherlands Antillesianawiki15pp..an
palaeolithistdefpalaeolithi.stwhois.stSao Tome and Principeianawiki13pp..st
palaeolithoiddefpalaeolitho.idwhois.idIndonesiaianawiki13pp..id
palaeologicaldefpalaeologic.alwhois.alAlbaniaianawiki13pp..al
palaeologistdefpalaeologi.stwhois.stSao Tome and Principeianawiki12pp..st
palaeologusdefpalaeolog.uswhois.usUnited Statesianawiki11pp..us
palaeologydefpalaeolo.gywhois.gyGuyanaianawiki10pp..gy
palaeomagnetismdefpalaeomagneti.smwhois.smSan Marinoianawiki15pp..sm
palaeometeorologicaldefpalaeometeorologic.alwhois.alAlbaniaianawiki20pp..al
palaeometeorologydefpalaeometeorolo.gywhois.gyGuyanaianawiki17pp..gy
palaeonemerteandefpalaeonemerte.anwhois.anNetherlands Antillesianawiki15pp..an
palaeonemertinedefpalaeonemerti.newhois.neNigerianawiki15pp..ne
palaeonemertinidefpalaeonemerti.niwhois.niNicaraguaianawiki15pp..ni
palaeonisciddefpalaeonisc.idwhois.idIndonesiaianawiki12pp..id
palaeoniscidaedefpalaeoniscid.aewhois.aeUnited Arab Emiratesianawiki14pp..ae
palaeoniscoiddefpalaeonisco.idwhois.idIndonesiaianawiki13pp..id
palaeoniscumdefpalaeonisc.umwhois.umUnited States Minor Outlying Islandsianawiki12pp..um
palaeoniscusdefpalaeonisc.uswhois.usUnited Statesianawiki12pp..us
palaeontographicaldefpalaeontographic.alwhois.alAlbaniaianawiki18pp..al
palaeontologicaldefpalaeontologic.alwhois.alAlbaniaianawiki16pp..al
palaeontologicallydefpalaeontological.lywhois.lyLibyan Arab Jamahiriyaianawiki18pp..ly
palaeontologiesdefpalaeontologi.eswhois.esSpainianawiki15pp..es
palaeontologistdefpalaeontologi.stwhois.stSao Tome and Principeianawiki15pp..st
palaeontologydefpalaeontolo.gywhois.gyGuyanaianawiki13pp..gy
palaeopathologydefpalaeopatholo.gywhois.gyGuyanaianawiki15pp..gy
palaeopedologydefpalaeopedolo.gywhois.gyGuyanaianawiki14pp..gy
palaeophilistdefpalaeophili.stwhois.stSao Tome and Principeianawiki13pp..st
palaeophisdefpalaeoph.iswhois.isIcelandianawiki10pp..is
palaeophysiologydefpalaeophysiolo.gywhois.gyGuyanaianawiki16pp..gy
palaeophytologicaldefpalaeophytologic.alwhois.alAlbaniaianawiki18pp..al
palaeophytologistdefpalaeophytologi.stwhois.stSao Tome and Principeianawiki17pp..st
palaeophytologydefpalaeophytolo.gywhois.gyGuyanaianawiki15pp..gy
palaeoplaindefpalaeopla.inwhois.inIndiaianawiki11pp..in
palaeopotamologydefpalaeopotamolo.gywhois.gyGuyanaianawiki16pp..gy
palaeopsychologicaldefpalaeopsychologic.alwhois.alAlbaniaianawiki19pp..al
palaeopsychologydefpalaeopsycholo.gywhois.gyGuyanaianawiki16pp..gy
palaeoptychologydefpalaeoptycholo.gywhois.gyGuyanaianawiki16pp..gy
palaeornisdefpalaeorn.iswhois.isIcelandianawiki10pp..is
palaeornithinaedefpalaeornithin.aewhois.aeUnited Arab Emiratesianawiki15pp..ae
palaeornithinedefpalaeornithi.newhois.neNigerianawiki14pp..ne
palaeornithologicaldefpalaeornithologic.alwhois.alAlbaniaianawiki19pp..al
palaeornithologydefpalaeornitholo.gywhois.gyGuyanaianawiki16pp..gy
palaeosaurusdefpalaeosaur.uswhois.usUnited Statesianawiki12pp..us
palaeospondylusdefpalaeospondyl.uswhois.usUnited Statesianawiki15pp..us
palaeostracadefpalaeostra.cawhois.caCanadaianawiki12pp..ca
palaeostracandefpalaeostrac.anwhois.anNetherlands Antillesianawiki13pp..an
palaeostriataldefpalaeostriat.alwhois.alAlbaniaianawiki14pp..al
palaeostriatumdefpalaeostriat.umwhois.umUnited States Minor Outlying Islandsianawiki14pp..um
palaeostylydefpalaeosty.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
palaeothalamusdefpalaeothalam.uswhois.usUnited Statesianawiki14pp..us
palaeothentesdefpalaeothent.eswhois.esSpainianawiki13pp..es
palaeothentidaedefpalaeothentid.aewhois.aeUnited Arab Emiratesianawiki15pp..ae
palaeotheredefpalaeothe.rewhois.reReunion Islandianawiki11pp..re
palaeotheriandefpalaeotheri.anwhois.anNetherlands Antillesianawiki13pp..an
palaeotheriidaedefpalaeotheriid.aewhois.aeUnited Arab Emiratesianawiki15pp..ae
palaeotherioiddefpalaeotherio.idwhois.idIndonesiaianawiki14pp..id
palaeotheriumdefpalaeotheri.umwhois.umUnited States Minor Outlying Islandsianawiki13pp..um
palaeotheroiddefpalaeothero.idwhois.idIndonesiaianawiki13pp..id
palaeotropicaldefpalaeotropic.alwhois.alAlbaniaianawiki14pp..al
palaeotypedefpalaeoty.pewhois.pePeruianawiki10pp..pe
palaeotypicaldefpalaeotypic.alwhois.alAlbaniaianawiki13pp..al
palaeotypicallydefpalaeotypical.lywhois.lyLibyan Arab Jamahiriyaianawiki15pp..ly
palaeotypographicaldefpalaeotypographic.alwhois.alAlbaniaianawiki19pp..al
palaeotypographistdefpalaeotypographi.stwhois.stSao Tome and Principeianawiki18pp..st
palaeozoologicaldefpalaeozoologic.alwhois.alAlbaniaianawiki16pp..al
palaeozoologistdefpalaeozoologi.stwhois.stSao Tome and Principeianawiki15pp..st
palaeozoologydefpalaeozoolo.gywhois.gyGuyanaianawiki13pp..gy
palaestraedefpalaestr.aewhois.aeUnited Arab Emiratesianawiki10pp..ae
palaestraldefpalaestr.alwhois.alAlbaniaianawiki10pp..al
palaestrasdefpalaestr.aswhois.asAmerican Samoaianawiki10pp..as
palaestriandefpalaestri.anwhois.anNetherlands Antillesianawiki11pp..an
palaestricsdefpalaestri.cswhois.csSerbia and Montenegroianawiki11pp..cs
palaetiologicaldefpalaetiologic.alwhois.alAlbaniaianawiki15pp..al
palaetiologistdefpalaetiologi.stwhois.stSao Tome and Principeianawiki14pp..st
palaetiologydefpalaetiolo.gywhois.gyGuyanaianawiki12pp..gy
palaihnihandefpalaihnih.anwhois.anNetherlands Antillesianawiki11pp..an
palaiotypedefpalaioty.pewhois.pePeruianawiki10pp..pe
palaisdefpala.iswhois.isIcelandianawiki6pp..is
palaisdedansedefpalaisdedan.sewhois.seSwedenianawiki13pp..se
palaisglidedefpalaisgli.dewhois.deGermanyianawiki11pp..de
palaladefpala.lawhois.laLao People's Democratic Republicianawiki6pp..la
palamadefpala.mawhois.maMoroccoianawiki6pp..ma
palamaedefpalam.aewhois.aeUnited Arab Emiratesianawiki7pp..ae
palamedeandefpalamede.anwhois.anNetherlands Antillesianawiki10pp..an
palamedeidaedefpalamedeid.aewhois.aeUnited Arab Emiratesianawiki12pp..ae
palamedesdefpalamed.eswhois.esSpainianawiki9pp..es
palamitismdefpalamiti.smwhois.smSan Marinoianawiki10pp..sm
palamporedefpalampo.rewhois.reReunion Islandianawiki9pp..re
palanderdefpaland.erwhois.erEritreaianawiki8pp..er
palankeenerdefpalankeen.erwhois.erEritreaianawiki11pp..er
palankeeningdefpalankeeni.ngwhois.ngNigeriaianawiki12pp..ng
palankeeninglydefpalankeening.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
palanquindefpalanqu.inwhois.inIndiaianawiki9pp..in
palanquinerdefpalanquin.erwhois.erEritreaianawiki11pp..er
palanquiningdefpalanquini.ngwhois.ngNigeriaianawiki12pp..ng
palanquininglydefpalanquining.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
palapaladefpalapa.lawhois.laLao People's Democratic Republicianawiki8pp..la
palapalaidefpalapal.aiwhois.aiAnguillaianawiki9pp..ai
palaquiumdefpalaqui.umwhois.umUnited States Minor Outlying Islandsianawiki9pp..um
palardefpal.arwhois.arArgentinaianawiki5pp..ar
palaroundwithdefpalaroundwi.thwhois.thThailandianawiki13pp..th
palasdefpal.aswhois.asAmerican Samoaianawiki5pp..as
palaskinodefpalaski.nowhois.noNorwayianawiki9pp..no
palatablydefpalatab.lywhois.lyLibyan Arab Jamahiriyaianawiki9pp..ly
palataldefpalat.alwhois.alAlbaniaianawiki7pp..al
palatalismdefpalatali.smwhois.smSan Marinoianawiki10pp..sm
palatallydefpalatal.lywhois.lyLibyan Arab Jamahiriyaianawiki9pp..ly
palatalsdefpalata.lswhois.lsLesothoianawiki8pp..ls
palatebonedefpalatebo.newhois.neNigerianawiki10pp..ne
palatelikedefpalateli.kewhois.keKenyaianawiki10pp..ke
palatesdefpalat.eswhois.esSpainianawiki7pp..es
palatialdefpalati.alwhois.alAlbaniaianawiki8pp..al
palatiallydefpalatial.lywhois.lyLibyan Arab Jamahiriyaianawiki10pp..ly
palatiandefpalati.anwhois.anNetherlands Antillesianawiki8pp..an
palatinaldefpalatin.alwhois.alAlbaniaianawiki9pp..al
palatinatesdefpalatinat.eswhois.esSpainianawiki11pp..es
palatinedefpalati.newhois.neNigerianawiki8pp..ne
palatinesdefpalatin.eswhois.esSpainianawiki9pp..es
palatinetonsildefpalatinetons.ilwhois.ilIsraelianawiki14pp..il
palatiniandefpalatini.anwhois.anNetherlands Antillesianawiki10pp..an
palatistdefpalati.stwhois.stSao Tome and Principeianawiki8pp..st
palatitisdefpalatit.iswhois.isIcelandianawiki9pp..is
palatiumdefpalati.umwhois.umUnited States Minor Outlying Islandsianawiki8pp..um
palativedefpalati.vewhois.veVenezuelaianawiki8pp..ve
palatodefpala.towhois.toTongaianawiki6pp..to
palatoalveolardefpalatoalveol.arwhois.arArgentinaianawiki14pp..ar
palatodentaldefpalatodent.alwhois.alAlbaniaianawiki12pp..al
palatoglossaldefpalatogloss.alwhois.alAlbaniaianawiki13pp..al
palatoglossusdefpalatogloss.uswhois.usUnited Statesianawiki13pp..us
palatognathousdefpalatognatho.uswhois.usUnited Statesianawiki14pp..us
palatogramdefpalatogr.amwhois.amArmeniaianawiki10pp..am
palatographdefpalatogra.phwhois.phPhilippinesianawiki11pp..ph
palatometerdefpalatomet.erwhois.erEritreaianawiki11pp..er
palatonasaldefpalatonas.alwhois.alAlbaniaianawiki11pp..al
palatopharyngealdefpalatopharynge.alwhois.alAlbaniaianawiki16pp..al
palatopharyngeusdefpalatopharynge.uswhois.usUnited Statesianawiki16pp..us
palatopterygoiddefpalatopterygo.idwhois.idIndonesiaianawiki15pp..id
palatoschisisdefpalatoschis.iswhois.isIcelandianawiki13pp..is
palatuadefpalat.uawhois.uaUkraineianawiki7pp..ua
palaudefpal.auwhois.auAustraliaianawiki5pp..au
palaungdefpalau.ngwhois.ngNigeriaianawiki7pp..ng
palaverdefpalav.erwhois.erEritreaianawiki7pp..er
palavererdefpalaver.erwhois.erEritreaianawiki9pp..er
palaveringdefpalaveri.ngwhois.ngNigeriaianawiki10pp..ng
palaveristdefpalaveri.stwhois.stSao Tome and Principeianawiki10pp..st
palaverousdefpalavero.uswhois.usUnited Statesianawiki10pp..us
palawandefpalaw.anwhois.anNetherlands Antillesianawiki7pp..an
palayandefpalay.anwhois.anNetherlands Antillesianawiki7pp..an
palchdefpal.chwhois.chSwitzerlandianawiki5pp..ch
palcodefpal.cowhois.coColombiaianawiki5pp..co
paleaceousdefpaleaceo.uswhois.usUnited Statesianawiki10pp..us
paleaedefpale.aewhois.aeUnited Arab Emiratesianawiki6pp..ae
palealdefpale.alwhois.alAlbaniaianawiki6pp..al
paleasacorpsedefpaleasacorp.sewhois.seSwedenianawiki13pp..se
paleasaforpinedghostdefpaleasaforpinedgho.stwhois.stSao Tome and Principeianawiki20pp..st
paleasaghostdefpaleasagho.stwhois.stSao Tome and Principeianawiki12pp..st
paleasdeathdefpaleasdea.thwhois.thThailandianawiki11pp..th
palebellydefpalebel.lywhois.lyLibyan Arab Jamahiriyaianawiki9pp..ly
palebreastdefpalebrea.stwhois.stSao Tome and Principeianawiki10pp..st
palebrightdefpalebrig.htwhois.htHaitiianawiki10pp..ht
palebroomrapedefpalebroomra.pewhois.pePeruianawiki13pp..pe
palebuckdefpalebu.ckwhois.ckCook Islandsianawiki8pp..ck
palecatechudefpalecatec.huwhois.huHungaryianawiki11pp..hu
palechinoiddefpalechino.idwhois.idIndonesiaianawiki11pp..id
palecorydalisdefpalecorydal.iswhois.isIcelandianawiki13pp..is
paledeathdefpaledea.thwhois.thThailandianawiki9pp..th
paleelderdefpaleeld.erwhois.erEritreaianawiki9pp..er
paleencephaladefpaleencepha.lawhois.laLao People's Democratic Republicianawiki13pp..la
paleentomologydefpaleentomolo.gywhois.gyGuyanaianawiki14pp..gy
paleethnographerdefpaleethnograph.erwhois.erEritreaianawiki16pp..er
paleethnologicaldefpaleethnologic.alwhois.alAlbaniaianawiki16pp..al
paleethnologistdefpaleethnologi.stwhois.stSao Tome and Principeianawiki15pp..st
paleethnologydefpaleethnolo.gywhois.gyGuyanaianawiki13pp..gy
palefacesdefpalefac.eswhois.esSpainianawiki9pp..es
palehorsedefpalehor.sewhois.seSwedenianawiki9pp..se
paleichthyologistdefpaleichthyologi.stwhois.stSao Tome and Principeianawiki17pp..st
paleichthyologydefpaleichthyolo.gywhois.gyGuyanaianawiki15pp..gy
palelookingdefpalelooki.ngwhois.ngNigeriaianawiki11pp..ng
palelydefpale.lywhois.lyLibyan Arab Jamahiriyaianawiki6pp..ly
palemandefpalem.anwhois.anNetherlands Antillesianawiki7pp..an
palembangdefpalemba.ngwhois.ngNigeriaianawiki9pp..ng
palenessesdefpaleness.eswhois.esSpainianawiki10pp..es
paleoalchemicaldefpaleoalchemic.alwhois.alAlbaniaianawiki15pp..al
paleoamericandefpaleoameric.anwhois.anNetherlands Antillesianawiki13pp..an
paleoanthropologicaldefpaleoanthropologic.alwhois.alAlbaniaianawiki20pp..al
paleoanthropologistdefpaleoanthropologi.stwhois.stSao Tome and Principeianawiki19pp..st
paleoanthropologydefpaleoanthropolo.gywhois.gyGuyanaianawiki17pp..gy
paleoanthropusdefpaleoanthrop.uswhois.usUnited Statesianawiki14pp..us
paleoatavismdefpaleoatavi.smwhois.smSan Marinoianawiki12pp..sm
paleobiologicaldefpaleobiologic.alwhois.alAlbaniaianawiki15pp..al
paleobiologistdefpaleobiologi.stwhois.stSao Tome and Principeianawiki14pp..st
paleobiologydefpaleobiolo.gywhois.gyGuyanaianawiki12pp..gy
paleobotanicaldefpaleobotanic.alwhois.alAlbaniaianawiki14pp..al
paleobotanicallydefpaleobotanical.lywhois.lyLibyan Arab Jamahiriyaianawiki16pp..ly
paleobotanistdefpaleobotani.stwhois.stSao Tome and Principeianawiki13pp..st
paleocenedefpaleoce.newhois.neNigerianawiki9pp..ne
paleochorologistdefpaleochorologi.stwhois.stSao Tome and Principeianawiki16pp..st
paleochorologydefpaleochorolo.gywhois.gyGuyanaianawiki14pp..gy
paleochristiandefpaleochristi.anwhois.anNetherlands Antillesianawiki14pp..an
paleoclimatologicaldefpaleoclimatologic.alwhois.alAlbaniaianawiki19pp..al
paleoclimatologistdefpaleoclimatologi.stwhois.stSao Tome and Principeianawiki18pp..st
paleoclimatologydefpaleoclimatolo.gywhois.gyGuyanaianawiki16pp..gy
paleocosmologydefpaleocosmolo.gywhois.gyGuyanaianawiki14pp..gy
paleocrystaldefpaleocryst.alwhois.alAlbaniaianawiki12pp..al
paleocrystallinedefpaleocrystalli.newhois.neNigerianawiki16pp..ne
paleodendrologicaldefpaleodendrologic.alwhois.alAlbaniaianawiki18pp..al
paleodendrologicallydefpaleodendrological.lywhois.lyLibyan Arab Jamahiriyaianawiki20pp..ly
paleodendrologistdefpaleodendrologi.stwhois.stSao Tome and Principeianawiki17pp..st
paleodendrologydefpaleodendrolo.gywhois.gyGuyanaianawiki15pp..gy
paleodentrologistdefpaleodentrologi.stwhois.stSao Tome and Principeianawiki17pp..st
paleoecologicaldefpaleoecologic.alwhois.alAlbaniaianawiki15pp..al
paleoecologistdefpaleoecologi.stwhois.stSao Tome and Principeianawiki14pp..st
paleoecologydefpaleoecolo.gywhois.gyGuyanaianawiki12pp..gy
paleoentomologicaldefpaleoentomologic.alwhois.alAlbaniaianawiki18pp..al
paleoentomologistdefpaleoentomologi.stwhois.stSao Tome and Principeianawiki17pp..st
paleoeremologydefpaleoeremolo.gywhois.gyGuyanaianawiki14pp..gy
paleoeskimodefpaleoeski.mowhois.moMacauianawiki11pp..mo
paleoethnologicaldefpaleoethnologic.alwhois.alAlbaniaianawiki17pp..al
paleoethnologistdefpaleoethnologi.stwhois.stSao Tome and Principeianawiki16pp..st
paleoethnologydefpaleoethnolo.gywhois.gyGuyanaianawiki14pp..gy
paleofaunadefpaleofau.nawhois.naNamibiaianawiki10pp..na
paleogenedefpaleoge.newhois.neNigerianawiki9pp..ne
paleogenesisdefpaleogenes.iswhois.isIcelandianawiki12pp..is
paleogeographicaldefpaleogeographic.alwhois.alAlbaniaianawiki17pp..al
paleogeographicallydefpaleogeographical.lywhois.lyLibyan Arab Jamahiriyaianawiki19pp..ly
paleoglaciologistdefpaleoglaciologi.stwhois.stSao Tome and Principeianawiki17pp..st
paleoglaciologydefpaleoglaciolo.gywhois.gyGuyanaianawiki15pp..gy
paleoglyphdefpaleogly.phwhois.phPhilippinesianawiki10pp..ph
paleographdefpaleogra.phwhois.phPhilippinesianawiki10pp..ph
paleographerdefpaleograph.erwhois.erEritreaianawiki12pp..er
paleographicaldefpaleographic.alwhois.alAlbaniaianawiki14pp..al
paleographicallydefpaleographical.lywhois.lyLibyan Arab Jamahiriyaianawiki16pp..ly
paleographistdefpaleographi.stwhois.stSao Tome and Principeianawiki13pp..st
paleoherpetologistdefpaleoherpetologi.stwhois.stSao Tome and Principeianawiki18pp..st
paleoherpetologydefpaleoherpetolo.gywhois.gyGuyanaianawiki16pp..gy
paleohistologydefpaleohistolo.gywhois.gyGuyanaianawiki14pp..gy
paleoichthyologydefpaleoichthyolo.gywhois.gyGuyanaianawiki16pp..gy
paleoladefpaleo.lawhois.laLao People's Democratic Republicianawiki7pp..la
paleolimnologydefpaleolimnolo.gywhois.gyGuyanaianawiki14pp..gy
paleolithdefpaleoli.thwhois.thThailandianawiki9pp..th
paleolithicaldefpaleolithic.alwhois.alAlbaniaianawiki13pp..al
paleolithicmandefpaleolithicm.anwhois.anNetherlands Antillesianawiki14pp..an
paleolithistdefpaleolithi.stwhois.stSao Tome and Principeianawiki12pp..st
paleolithoiddefpaleolitho.idwhois.idIndonesiaianawiki12pp..id
paleologicaldefpaleologic.alwhois.alAlbaniaianawiki12pp..al
paleologistdefpaleologi.stwhois.stSao Tome and Principeianawiki11pp..st
paleologydefpaleolo.gywhois.gyGuyanaianawiki9pp..gy
paleomagneticallydefpaleomagnetical.lywhois.lyLibyan Arab Jamahiriyaianawiki17pp..ly
paleomagnetismdefpaleomagneti.smwhois.smSan Marinoianawiki14pp..sm
paleomagnetistdefpaleomagneti.stwhois.stSao Tome and Principeianawiki14pp..st
paleomammalogydefpaleomammalo.gywhois.gyGuyanaianawiki14pp..gy
paleomammologistdefpaleomammologi.stwhois.stSao Tome and Principeianawiki16pp..st
paleomammologydefpaleomammolo.gywhois.gyGuyanaianawiki14pp..gy
paleometeorologicaldefpaleometeorologic.alwhois.alAlbaniaianawiki19pp..al
paleometeorologistdefpaleometeorologi.stwhois.stSao Tome and Principeianawiki18pp..st
paleometeorologydefpaleometeorolo.gywhois.gyGuyanaianawiki16pp..gy
paleontographicaldefpaleontographic.alwhois.alAlbaniaianawiki17pp..al
paleontologicaldefpaleontologic.alwhois.alAlbaniaianawiki15pp..al
paleontologicalgeologydefpaleontologicalgeolo.gywhois.gyGuyanaianawiki22pp..gy
paleontologicallydefpaleontological.lywhois.lyLibyan Arab Jamahiriyaianawiki17pp..ly
paleontologiesdefpaleontologi.eswhois.esSpainianawiki14pp..es
paleontologistdefpaleontologi.stwhois.stSao Tome and Principeianawiki14pp..st
paleontologydefpaleontolo.gywhois.gyGuyanaianawiki12pp..gy
paleopathologicaldefpaleopathologic.alwhois.alAlbaniaianawiki17pp..al
paleopathologistdefpaleopathologi.stwhois.stSao Tome and Principeianawiki16pp..st
paleopathologydefpaleopatholo.gywhois.gyGuyanaianawiki14pp..gy
paleopedologydefpaleopedolo.gywhois.gyGuyanaianawiki13pp..gy
paleophysiologistdefpaleophysiologi.stwhois.stSao Tome and Principeianawiki17pp..st
paleophysiologydefpaleophysiolo.gywhois.gyGuyanaianawiki15pp..gy
paleophytologicaldefpaleophytologic.alwhois.alAlbaniaianawiki17pp..al
paleophytologistdefpaleophytologi.stwhois.stSao Tome and Principeianawiki16pp..st
paleophytologydefpaleophytolo.gywhois.gyGuyanaianawiki14pp..gy
paleoplaindefpaleopla.inwhois.inIndiaianawiki10pp..in
paleopotamologydefpaleopotamolo.gywhois.gyGuyanaianawiki15pp..gy
paleopsychologicaldefpaleopsychologic.alwhois.alAlbaniaianawiki18pp..al
paleopsychologydefpaleopsycholo.gywhois.gyGuyanaianawiki15pp..gy
paleornithologicaldefpaleornithologic.alwhois.alAlbaniaianawiki18pp..al
paleornithologistdefpaleornithologi.stwhois.stSao Tome and Principeianawiki17pp..st
paleornithologydefpaleornitholo.gywhois.gyGuyanaianawiki15pp..gy
paleosiberiandefpaleosiberi.anwhois.anNetherlands Antillesianawiki13pp..an
paleostriataldefpaleostriat.alwhois.alAlbaniaianawiki13pp..al
paleostriatumdefpaleostriat.umwhois.umUnited States Minor Outlying Islandsianawiki13pp..um
paleostylydefpaleosty.lywhois.lyLibyan Arab Jamahiriyaianawiki10pp..ly
paleothalamusdefpaleothalam.uswhois.usUnited Statesianawiki13pp..us
paleothermaldefpaleotherm.alwhois.alAlbaniaianawiki12pp..al
paleotropicaldefpaleotropic.alwhois.alAlbaniaianawiki13pp..al
paleoytterbiumdefpaleoytterbi.umwhois.umUnited States Minor Outlying Islandsianawiki14pp..um
paleozoologicaldefpaleozoologic.alwhois.alAlbaniaianawiki15pp..al
paleozoologistdefpaleozoologi.stwhois.stSao Tome and Principeianawiki14pp..st
paleozoologydefpaleozoolo.gywhois.gyGuyanaianawiki12pp..gy
palerdefpal.erwhois.erEritreaianawiki5pp..er
palereddishdefpalereddi.shwhois.shSaint Helenaianawiki11pp..sh
paleriderdefpalerid.erwhois.erEritreaianawiki9pp..er
palermitandefpalermit.anwhois.anNetherlands Antillesianawiki10pp..an
palermodefpaler.mowhois.moMacauianawiki7pp..mo
palesdefpal.eswhois.esSpainianawiki5pp..es
palesmandefpalesm.anwhois.anNetherlands Antillesianawiki8pp..an
palestdefpale.stwhois.stSao Tome and Principeianawiki6pp..st
palestinedefpalesti.newhois.neNigerianawiki9pp..ne
palestiniandefpalestini.anwhois.anNetherlands Antillesianawiki11pp..an
palestraedefpalestr.aewhois.aeUnited Arab Emiratesianawiki9pp..ae
palestraldefpalestr.alwhois.alAlbaniaianawiki9pp..al
palestrasdefpalestr.aswhois.asAmerican Samoaianawiki9pp..as
palestriandefpalestri.anwhois.anNetherlands Antillesianawiki10pp..an
palestrinadefpalestri.nawhois.naNamibiaianawiki10pp..na
palesweevildefpalesweev.ilwhois.ilIsraelianawiki11pp..il
paletdefpal.etwhois.etEthiopiaianawiki5pp..et
paletiologydefpaletiolo.gywhois.gyGuyanaianawiki11pp..gy
palettelikedefpaletteli.kewhois.keKenyaianawiki11pp..ke
paletteofnarmerdefpaletteofnarm.erwhois.erEritreaianawiki15pp..er
palettesdefpalett.eswhois.esSpainianawiki8pp..es
paletzdefpale.tzwhois.tzTanzaniaianawiki6pp..tz
palewisedefpalewi.sewhois.seSwedenianawiki8pp..se
palfrenierdefpalfreni.erwhois.erEritreaianawiki10pp..er
palgatdefpalg.atwhois.atAustriaianawiki6pp..at
palgravedefpalgra.vewhois.veVenezuelaianawiki8pp..ve
palidefpa.liwhois.liLiechtensteinianawiki4pp..li
palicidefpali.ciwhois.ciCote d'Ivoireianawiki6pp..ci
palierdefpali.erwhois.erEritreaianawiki6pp..er
paliestdefpalie.stwhois.stSao Tome and Principeianawiki7pp..st
palikardefpalik.arwhois.arArgentinaianawiki7pp..ar
palikarismdefpalikari.smwhois.smSan Marinoianawiki10pp..sm
paliladefpali.lawhois.laLao People's Democratic Republicianawiki6pp..la
paliliciumdefpalilici.umwhois.umUnited States Minor Outlying Islandsianawiki10pp..um
palilogydefpalilo.gywhois.gyGuyanaianawiki8pp..gy
palimbacchiusdefpalimbacchi.uswhois.usUnited Statesianawiki13pp..us
palimpsestdefpalimpse.stwhois.stSao Tome and Principeianawiki10pp..st
palimpsetdefpalimps.etwhois.etEthiopiaianawiki9pp..et
palinaldefpalin.alwhois.alAlbaniaianawiki7pp..al
palindromesdefpalindrom.eswhois.esSpainianawiki11pp..es
palindromicaldefpalindromic.alwhois.alAlbaniaianawiki13pp..al
palindromicallydefpalindromical.lywhois.lyLibyan Arab Jamahiriyaianawiki15pp..ly
palindromistdefpalindromi.stwhois.stSao Tome and Principeianawiki12pp..st
palingdefpali.ngwhois.ngNigeriaianawiki6pp..ng
palingenesiandefpalingenesi.anwhois.anNetherlands Antillesianawiki13pp..an
palingenesisdefpalingenes.iswhois.isIcelandianawiki12pp..is
palingenesistdefpalingenesi.stwhois.stSao Tome and Principeianawiki13pp..st
palingenesydefpalingene.sywhois.sySyrian Arab Republicianawiki11pp..sy
palingeneticallydefpalingenetical.lywhois.lyLibyan Arab Jamahiriyaianawiki16pp..ly
palingenistdefpalingeni.stwhois.stSao Tome and Principeianawiki11pp..st
palingsdefpalin.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki7pp..gs
palinodedefpalino.dewhois.deGermanyianawiki8pp..de
palinodesdefpalinod.eswhois.esSpainianawiki9pp..es
palinodialdefpalinodi.alwhois.alAlbaniaianawiki10pp..al
palinodistdefpalinodi.stwhois.stSao Tome and Principeianawiki10pp..st
palinuriddefpalinur.idwhois.idIndonesiaianawiki9pp..id
palinuridaedefpalinurid.aewhois.aeUnited Arab Emiratesianawiki11pp..ae
palinuroiddefpalinuro.idwhois.idIndonesiaianawiki10pp..id
palinurusdefpalinur.uswhois.usUnited Statesianawiki9pp..us
paliphrasiadefpaliphr.asiawhois.asiaDotAsia OrganizationN/Awiki11pp..asia
palisdefpal.iswhois.isIcelandianawiki5pp..is
palisadefpali.sawhois.saSaudi Arabiaianawiki6pp..sa
palisadedefpalisa.dewhois.deGermanyianawiki8pp..de
palisadeparenchymadefpalisadeparenchy.mawhois.maMoroccoianawiki18pp..ma
palisadesdefpalisad.eswhois.esSpainianawiki9pp..es
palisadingdefpalisadi.ngwhois.ngNigeriaianawiki10pp..ng
palisadodefpalisa.dowhois.doDominican Republicianawiki8pp..do
palisadoesdefpalisado.eswhois.esSpainianawiki10pp..es
palisadoingdefpalisadoi.ngwhois.ngNigeriaianawiki11pp..ng
palisanderdefpalisand.erwhois.erEritreaianawiki10pp..er
palishdefpali.shwhois.shSaint Helenaianawiki6pp..sh
palissedefpalis.sewhois.seSwedenianawiki7pp..se
palissydefpalis.sywhois.sySyrian Arab Republicianawiki7pp..sy
palissywaredefpalissywa.rewhois.reReunion Islandianawiki11pp..re
palitzschdefpalitzs.chwhois.chSwitzerlandianawiki9pp..ch
paliurusdefpaliur.uswhois.usUnited Statesianawiki8pp..us
palkeedefpalk.eewhois.eeEstoniaianawiki6pp..ee
palkidefpal.kiwhois.kiKiribatiianawiki5pp..ki
palkstraitdefpalkstra.itwhois.itItalyianawiki10pp..it
palladefpal.lawhois.laLao People's Democratic Republicianawiki5pp..la
palladammindefpalladamm.inwhois.inIndiaianawiki11pp..in
palladamminedefpalladammi.newhois.neNigerianawiki12pp..ne
palladiandefpalladi.anwhois.anNetherlands Antillesianawiki9pp..an
palladianismdefpalladiani.smwhois.smSan Marinoianawiki12pp..sm
palladiferousdefpalladifero.uswhois.usUnited Statesianawiki13pp..us
palladindefpallad.inwhois.inIndiaianawiki8pp..in
palladinizingdefpalladinizi.ngwhois.ngNigeriaianawiki13pp..ng
palladiodefpallad.iowhois.ioBritish Indian Ocean Territoryianawiki8pp..io
palladiousdefpalladio.uswhois.usUnited Statesianawiki10pp..us
palladiumdefpalladi.umwhois.umUnited States Minor Outlying Islandsianawiki9pp..um
palladiumizingdefpalladiumizi.ngwhois.ngNigeriaianawiki14pp..ng
palladiumsdefpalladiu.mswhois.msMontserratianawiki10pp..ms
palladiumspongedefpalladiumspon.gewhois.geGeorgiaianawiki15pp..ge
palladizingdefpalladizi.ngwhois.ngNigeriaianawiki11pp..ng
palladodiamminedefpalladodiammi.newhois.neNigerianawiki15pp..ne
palladosamminedefpalladosammi.newhois.neNigerianawiki14pp..ne
palladousdefpallado.uswhois.usUnited Statesianawiki9pp..us
pallaedefpall.aewhois.aeUnited Arab Emiratesianawiki6pp..ae
pallardefpall.arwhois.arArgentinaianawiki6pp..ar
pallasdefpall.aswhois.asAmerican Samoaianawiki6pp..as
pallasathenadefpallasathe.nawhois.naNamibiaianawiki12pp..na
pallasscatdefpallassc.atwhois.atAustriaianawiki10pp..at
pallasscatdefpallass.catwhois.catCatalan languageN/Awiki10pp..cat
pallbearerdefpallbear.erwhois.erEritreaianawiki10pp..er
palletdefpall.etwhois.etEthiopiaianawiki6pp..et
palleteyedefpallete.yewhois.yeYemenianawiki9pp..ye
palletingdefpalleti.ngwhois.ngNigeriaianawiki9pp..ng
palletizerdefpalletiz.erwhois.erEritreaianawiki10pp..er
palletizingdefpalletizi.ngwhois.ngNigeriaianawiki11pp..ng
palletleatherdefpalletleath.erwhois.erEritreaianawiki13pp..er
palletstonedefpalletsto.newhois.neNigerianawiki11pp..ne
pallettaildefpalletta.ilwhois.ilIsraelianawiki10pp..il
pallettesdefpallett.eswhois.esSpainianawiki9pp..es
pallholderdefpallhold.erwhois.erEritreaianawiki10pp..er
pallidefpal.liwhois.liLiechtensteinianawiki5pp..li
pallialdefpalli.alwhois.alAlbaniaianawiki7pp..al
pallialsinusdefpallialsin.uswhois.usUnited Statesianawiki12pp..us
palliassedefpallias.sewhois.seSwedenianawiki9pp..se
palliatesdefpalliat.eswhois.esSpainianawiki9pp..es
palliatingdefpalliati.ngwhois.ngNigeriaianawiki10pp..ng
palliativedefpalliati.vewhois.veVenezuelaianawiki10pp..ve
palliativelydefpalliative.lywhois.lyLibyan Arab Jamahiriyaianawiki12pp..ly
palliddefpall.idwhois.idIndonesiaianawiki6pp..id
pallidfuliginousdefpallidfuligino.uswhois.usUnited Statesianawiki16pp..us
pallidiflorousdefpallidifloro.uswhois.usUnited Statesianawiki14pp..us
pallidlookingdefpallidlooki.ngwhois.ngNigeriaianawiki13pp..ng
pallidlydefpallid.lywhois.lyLibyan Arab Jamahiriyaianawiki8pp..ly
pallidochraceousdefpallidochraceo.uswhois.usUnited Statesianawiki16pp..us
pallidtomentosedefpallidtomento.sewhois.seSwedenianawiki15pp..se
pallierdefpalli.erwhois.erEritreaianawiki7pp..er
palliesdefpalli.eswhois.esSpainianawiki7pp..es
palliestdefpallie.stwhois.stSao Tome and Principeianawiki8pp..st
pallingdefpalli.ngwhois.ngNigeriaianawiki7pp..ng
pallinidefpalli.niwhois.niNicaraguaianawiki7pp..ni
palliodefpall.iowhois.ioBritish Indian Ocean Territoryianawiki6pp..io
palliocardiacdefpalliocardi.acwhois.acAscension Islandianawiki13pp..ac
palliopedaldefpallioped.alwhois.alAlbaniaianawiki11pp..al
palliostratusdefpalliostrat.uswhois.usUnited Statesianawiki13pp..us
palliserdefpallis.erwhois.erEritreaianawiki8pp..er
palliumdefpalli.umwhois.umUnited States Minor Outlying Islandsianawiki7pp..um
palliumsdefpalliu.mswhois.msMontserratianawiki8pp..ms
palliyandefpalliy.anwhois.anNetherlands Antillesianawiki8pp..an
palllikedefpallli.kewhois.keKenyaianawiki8pp..ke
pallographdefpallogra.phwhois.phPhilippinesianawiki10pp..ph
pallonedefpallo.newhois.neNigerianawiki7pp..ne
pallsdefpal.lswhois.lsLesothoianawiki5pp..ls
palludefpal.luwhois.luLuxembourgianawiki5pp..lu
palluadefpall.uawhois.uaUkraineianawiki6pp..ua
palluitesdefpalluit.eswhois.esSpainianawiki9pp..es
pallwisedefpallwi.sewhois.seSwedenianawiki8pp..se
pallydefpal.lywhois.lyLibyan Arab Jamahiriyaianawiki5pp..ly
pallywalsydefpallywal.sywhois.sySyrian Arab Republicianawiki10pp..sy
palmadefpal.mawhois.maMoroccoianawiki5pp..ma
palmaceaedefpalmace.aewhois.aeUnited Arab Emiratesianawiki9pp..ae
palmaceousdefpalmaceo.uswhois.usUnited Statesianawiki10pp..us
palmaddefpalm.adwhois.adAndorraianawiki6pp..ad
palmademallorcadefpalmademallor.cawhois.caCanadaianawiki15pp..ca
palmaedefpalm.aewhois.aeUnited Arab Emiratesianawiki6pp..ae
palmardefpalm.arwhois.arArgentinaianawiki6pp..ar
palmariandefpalmari.anwhois.anNetherlands Antillesianawiki9pp..an
palmarisdefpalmar.iswhois.isIcelandianawiki8pp..is
palmarosaoildefpalmarosao.ilwhois.ilIsraelianawiki12pp..il
palmasdefpalm.aswhois.asAmerican Samoaianawiki6pp..as
palmasamandocadefpalmasamando.cawhois.caCanadaianawiki14pp..ca
palmatelydefpalmate.lywhois.lyLibyan Arab Jamahiriyaianawiki9pp..ly
palmatifiddefpalmatif.idwhois.idIndonesiaianawiki10pp..id
palmaturedefpalmatu.rewhois.reReunion Islandianawiki9pp..re
palmbeachdefpalmbea.chwhois.chSwitzerlandianawiki9pp..ch
palmbearingdefpalmbeari.ngwhois.ngNigeriaianawiki11pp..ng
palmbranchdefpalmbran.chwhois.chSwitzerlandianawiki10pp..ch
palmbutterdefpalmbutt.erwhois.erEritreaianawiki10pp..er
palmcabbagedefpalmcabba.gewhois.geGeorgiaianawiki11pp..ge
palmcapitaldefpalmcapit.alwhois.alAlbaniaianawiki11pp..al
palmcatdefpalmc.atwhois.atAustriaianawiki7pp..at
palmcatdefpalm.catwhois.catCatalan languageN/Awiki7pp..cat
palmchatdefpalmch.atwhois.atAustriaianawiki8pp..at
palmchristdefpalmchri.stwhois.stSao Tome and Principeianawiki10pp..st
palmcivetdefpalmciv.etwhois.etEthiopiaianawiki9pp..et
palmcoastdefpalmcoa.stwhois.stSao Tome and Principeianawiki9pp..st
palmcristdefpalmcri.stwhois.stSao Tome and Principeianawiki9pp..st
palmdovedefpalmdo.vewhois.veVenezuelaianawiki8pp..ve
palmelladefpalmel.lawhois.laLao People's Democratic Republicianawiki8pp..la
palmellaceaedefpalmellace.aewhois.aeUnited Arab Emiratesianawiki12pp..ae
palmellaceousdefpalmellaceo.uswhois.usUnited Statesianawiki13pp..us
palmellastagedefpalmellasta.gewhois.geGeorgiaianawiki13pp..ge
palmelloiddefpalmello.idwhois.idIndonesiaianawiki10pp..id
palmerdefpalm.erwhois.erEritreaianawiki6pp..er
palmerflydefpalmerf.lywhois.lyLibyan Arab Jamahiriyaianawiki9pp..ly
palmeriesdefpalmeri.eswhois.esSpainianawiki9pp..es
palmerindefpalmer.inwhois.inIndiaianawiki8pp..in
palmerpeninsuladefpalmerpeninsu.lawhois.laLao People's Democratic Republicianawiki15pp..la
palmerstonnorthdefpalmerstonnor.thwhois.thThailandianawiki15pp..th
palmertreedefpalmertr.eewhois.eeEstoniaianawiki10pp..ee
palmettesdefpalmett.eswhois.esSpainianawiki9pp..es
palmettodefpalmet.towhois.toTongaianawiki8pp..to
palmettoesdefpalmetto.eswhois.esSpainianawiki10pp..es
palmettoflagdefpalmettofl.agwhois.agAntigua and Barbudaianawiki12pp..ag
palmetumdefpalmet.umwhois.umUnited States Minor Outlying Islandsianawiki8pp..um
palmfamilydefpalmfami.lywhois.lyLibyan Arab Jamahiriyaianawiki10pp..ly
palmgreasedefpalmgrea.sewhois.seSwedenianawiki10pp..se
palmgreaserdefpalmgreas.erwhois.erEritreaianawiki11pp..er
palmgreasingdefpalmgreasi.ngwhois.ngNigeriaianawiki12pp..ng
palmhousedefpalmhou.sewhois.seSwedenianawiki9pp..se
palmicoleusdefpalmicole.uswhois.usUnited Statesianawiki11pp..us
palmicolousdefpalmicolo.uswhois.usUnited Statesianawiki11pp..us
palmierdefpalmi.erwhois.erEritreaianawiki7pp..er
palmiestdefpalmie.stwhois.stSao Tome and Principeianawiki8pp..st
palmiferousdefpalmifero.uswhois.usUnited Statesianawiki11pp..us
palmigradedefpalmigra.dewhois.deGermanyianawiki10pp..de
palmilladefpalmil.lawhois.laLao People's Democratic Republicianawiki8pp..la
palmindefpalm.inwhois.inIndiaianawiki6pp..in
palmingdefpalmi.ngwhois.ngNigeriaianawiki7pp..ng
palmipedesdefpalmiped.eswhois.esSpainianawiki10pp..es
palmipesdefpalmip.eswhois.esSpainianawiki8pp..es
palmirodefpalmi.rowhois.roRomaniaianawiki7pp..ro
palmistdefpalmi.stwhois.stSao Tome and Principeianawiki7pp..st
palmisterdefpalmist.erwhois.erEritreaianawiki9pp..er
palmistriesdefpalmistri.eswhois.esSpainianawiki11pp..es
palmiticaciddefpalmiticac.idwhois.idIndonesiaianawiki12pp..id
palmitindefpalmit.inwhois.inIndiaianawiki8pp..in
palmitinedefpalmiti.newhois.neNigerianawiki9pp..ne
palmitodefpalmi.towhois.toTongaianawiki7pp..to
palmitonedefpalmito.newhois.neNigerianawiki9pp..ne
palmivorousdefpalmivoro.uswhois.usUnited Statesianawiki11pp..us
palmkerneloildefpalmkernelo.ilwhois.ilIsraelianawiki13pp..il
palmleafdefpalmle.afwhois.afAfghanistanianawiki8pp..af
palmleaffandefpalmleaff.anwhois.anNetherlands Antillesianawiki11pp..an
palmleafhatdefpalmleafh.atwhois.atAustriaianawiki11pp..at
palmlikedefpalmli.kewhois.keKenyaianawiki8pp..ke
palmlilydefpalmli.lywhois.lyLibyan Arab Jamahiriyaianawiki8pp..ly
palmodefpal.mowhois.moMacauianawiki5pp..mo
palmoildefpalmo.ilwhois.ilIsraelianawiki7pp..il
palmolivedefpalmoli.vewhois.veVenezuelaianawiki9pp..ve
palmoredefpalmo.rewhois.reReunion Islandianawiki7pp..re
palmoscopydefpalmosco.pywhois.pyParaguayianawiki10pp..py
palmospasmusdefpalmospasm.uswhois.usUnited Statesianawiki12pp..us
palmpeachdefpalmpea.chwhois.chSwitzerlandianawiki9pp..ch
palmreaderdefpalmread.erwhois.erEritreaianawiki10pp..er
palmreadingdefpalmreadi.ngwhois.ngNigeriaianawiki11pp..ng
palmsdefpal.mswhois.msMontserratianawiki5pp..ms
palmspringsdefpalmsprin.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki11pp..gs
palmstarchdefpalmstar.chwhois.chSwitzerlandianawiki10pp..ch
palmsugardefpalmsug.arwhois.arArgentinaianawiki9pp..ar
palmtreedefpalmtr.eewhois.eeEstoniaianawiki8pp..ee
palmuladefpalmu.lawhois.laLao People's Democratic Republicianawiki7pp..la
palmusdefpalm.uswhois.usUnited Statesianawiki6pp..us
palmvaultingdefpalmvaulti.ngwhois.ngNigeriaianawiki12pp..ng
palmwarblerdefpalmwarbl.erwhois.erEritreaianawiki11pp..er
palmwaxdefpalmw.axwhois.axAland Islandsianawiki7pp..ax
palmweevildefpalmweev.ilwhois.ilIsraelianawiki10pp..il
palmwinedefpalmwi.newhois.neNigerianawiki8pp..ne
palmwisedefpalmwi.sewhois.seSwedenianawiki8pp..se
palmydefpal.mywhois.myMalaysiaianawiki5pp..my
palmyrasdefpalmyr.aswhois.asAmerican Samoaianawiki8pp..as
palmyrenedefpalmyre.newhois.neNigerianawiki9pp..ne
palmyreniandefpalmyreni.anwhois.anNetherlands Antillesianawiki11pp..an
paloaltodefpaloal.towhois.toTongaianawiki8pp..to
paloblancodefpaloblan.cowhois.coColombiaianawiki10pp..co
palocedrodefpaloced.rowhois.roRomaniaianawiki9pp..ro
paloczdefpalo.czwhois.czCzech Republicianawiki6pp..cz
palomadefpalo.mawhois.maMoroccoianawiki6pp..ma
palomardefpalom.arwhois.arArgentinaianawiki7pp..ar
palombinodefpalombi.nowhois.noNorwayianawiki9pp..no
palominodefpalomi.nowhois.noNorwayianawiki8pp..no
palookasdefpalook.aswhois.asAmerican Samoaianawiki8pp..as
palopintodefpalopin.towhois.toTongaianawiki9pp..to
palosapisdefpalosap.iswhois.isIcelandianawiki9pp..is
palosverdesestatesdefpalosverdesestat.eswhois.esSpainianawiki18pp..es
palousedefpalou.sewhois.seSwedenianawiki7pp..se
palouserdefpalous.erwhois.erEritreaianawiki8pp..er
paloverdedefpalover.dewhois.deGermanyianawiki9pp..de
palpablydefpalpab.lywhois.lyLibyan Arab Jamahiriyaianawiki8pp..ly
palpaldefpalp.alwhois.alAlbaniaianawiki6pp..al
palpatesdefpalpat.eswhois.esSpainianawiki8pp..es
palpatingdefpalpati.ngwhois.ngNigeriaianawiki9pp..ng
palpebraedefpalpebr.aewhois.aeUnited Arab Emiratesianawiki9pp..ae
palpebraldefpalpebr.alwhois.alAlbaniaianawiki9pp..al
palpebralfissuredefpalpebralfissu.rewhois.reReunion Islandianawiki16pp..re
palpebritisdefpalpebrit.iswhois.isIcelandianawiki11pp..is
palpiferdefpalpif.erwhois.erEritreaianawiki8pp..er
palpiferousdefpalpifero.uswhois.usUnited Statesianawiki11pp..us
palpigerdefpalpig.erwhois.erEritreaianawiki8pp..er
palpigerousdefpalpigero.uswhois.usUnited Statesianawiki11pp..us
palpitatesdefpalpitat.eswhois.esSpainianawiki10pp..es
palpitatingdefpalpitati.ngwhois.ngNigeriaianawiki11pp..ng
palpitatinglydefpalpitating.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
palpocildefpalpoc.ilwhois.ilIsraelianawiki8pp..il
palpsdefpal.pswhois.psPalestinian Territory (Occupied)ianawiki5pp..ps
palpulusdefpalpul.uswhois.usUnited Statesianawiki8pp..us
palpusdefpalp.uswhois.usUnited Statesianawiki6pp..us
palsdefpa.lswhois.lsLesothoianawiki4pp..ls
palsgrafdefpalsgr.afwhois.afAfghanistanianawiki8pp..af
palsgravedefpalsgra.vewhois.veVenezuelaianawiki9pp..ve
palsgravinedefpalsgravi.newhois.neNigerianawiki11pp..ne
palshipsdefpalshi.pswhois.psPalestinian Territory (Occupied)ianawiki8pp..ps
palsiesdefpalsi.eswhois.esSpainianawiki7pp..es
palstavedefpalsta.vewhois.veVenezuelaianawiki8pp..ve
palsterdefpalst.erwhois.erEritreaianawiki7pp..er
palsydefpal.sywhois.sySyrian Arab Republicianawiki5pp..sy
palsyingdefpalsyi.ngwhois.ngNigeriaianawiki8pp..ng
palsylikedefpalsyli.kewhois.keKenyaianawiki9pp..ke
palsyquakingdefpalsyquaki.ngwhois.ngNigeriaianawiki12pp..ng
palsyshakingdefpalsyshaki.ngwhois.ngNigeriaianawiki12pp..ng
palsysickdefpalsysi.ckwhois.ckCook Islandsianawiki9pp..ck
palsystruckdefpalsystru.ckwhois.ckCook Islandsianawiki11pp..ck
palsywalsydefpalsywal.sywhois.sySyrian Arab Republicianawiki10pp..sy
paltdefpa.ltwhois.ltLithuaniaianawiki4pp..lt
palterdefpalt.erwhois.erEritreaianawiki6pp..er
paltererdefpalter.erwhois.erEritreaianawiki8pp..er
palteringdefpalteri.ngwhois.ngNigeriaianawiki9pp..ng
palterlydefpalter.lywhois.lyLibyan Arab Jamahiriyaianawiki8pp..ly
paltockdefpalto.ckwhois.ckCook Islandsianawiki7pp..ck
paltrierdefpaltri.erwhois.erEritreaianawiki8pp..er
paltriestdefpaltrie.stwhois.stSao Tome and Principeianawiki9pp..st
paltrilydefpaltri.lywhois.lyLibyan Arab Jamahiriyaianawiki8pp..ly
paltryaffairdefpaltryaffa.irwhois.irIran, Islamic Republic ofianawiki12pp..ir
paluadefpal.uawhois.uaUkraineianawiki5pp..ua
paluasdefpalu.aswhois.asAmerican Samoaianawiki6pp..as
paludaldefpalud.alwhois.alAlbaniaianawiki7pp..al
paludalfeverdefpaludalfev.erwhois.erEritreaianawiki12pp..er
paludamentumdefpaludament.umwhois.umUnited States Minor Outlying Islandsianawiki12pp..um
paludedefpalu.dewhois.deGermanyianawiki6pp..de
paludialdefpaludi.alwhois.alAlbaniaianawiki8pp..al
paludiandefpaludi.anwhois.anNetherlands Antillesianawiki8pp..an
paludicelladefpaludicel.lawhois.laLao People's Democratic Republicianawiki11pp..la
paludicolaedefpaludicol.aewhois.aeUnited Arab Emiratesianawiki11pp..ae
paludicolinedefpaludicoli.newhois.neNigerianawiki12pp..ne
paludicolousdefpaludicolo.uswhois.usUnited Statesianawiki12pp..us
paludiferousdefpaludifero.uswhois.usUnited Statesianawiki12pp..us
paludinadefpaludi.nawhois.naNamibiaianawiki8pp..na
paludinaldefpaludin.alwhois.alAlbaniaianawiki9pp..al
paludinedefpaludi.newhois.neNigerianawiki8pp..ne
paludinousdefpaludino.uswhois.usUnited Statesianawiki10pp..us
paludismdefpaludi.smwhois.smSan Marinoianawiki8pp..sm
paludismsdefpaludis.mswhois.msMontserratianawiki9pp..ms
paludosedefpaludo.sewhois.seSwedenianawiki8pp..se
paludousdefpaludo.uswhois.usUnited Statesianawiki8pp..us
paludrindefpaludr.inwhois.inIndiaianawiki8pp..in
paludrinedefpaludri.newhois.neNigerianawiki9pp..ne
palulidefpalu.liwhois.liLiechtensteinianawiki6pp..li
palulusdefpalul.uswhois.usUnited Statesianawiki7pp..us
palumbodefpalum.bowhois.boBoliviaianawiki7pp..bo
palupwithdefpalupwi.thwhois.thThailandianawiki9pp..th
palusdefpal.uswhois.usUnited Statesianawiki5pp..us
palusepidemiarumdefpalusepidemiar.umwhois.umUnited States Minor Outlying Islandsianawiki16pp..um
palusnebularumdefpalusnebular.umwhois.umUnited States Minor Outlying Islandsianawiki14pp..um
palusputredinisdefpalusputredin.iswhois.isIcelandianawiki15pp..is
palussomnidefpalussom.niwhois.niNicaraguaianawiki10pp..ni
palustraldefpalustr.alwhois.alAlbaniaianawiki9pp..al
palustriandefpalustri.anwhois.anNetherlands Antillesianawiki10pp..an
palustrinedefpalustri.newhois.neNigerianawiki10pp..ne
palwithdefpalwi.thwhois.thThailandianawiki7pp..th
palydefpa.lywhois.lyLibyan Arab Jamahiriyaianawiki4pp..ly
palynologicaldefpalynologic.alwhois.alAlbaniaianawiki13pp..al
palynologicallydefpalynological.lywhois.lyLibyan Arab Jamahiriyaianawiki15pp..ly
palynologistdefpalynologi.stwhois.stSao Tome and Principeianawiki12pp..st
palynologydefpalynolo.gywhois.gyGuyanaianawiki10pp..gy
palynomorphdefpalynomor.phwhois.phPhilippinesianawiki11pp..ph
pamdefp.amwhois.amArmeniaianawiki3pp..am
pamaceousdefpamaceo.uswhois.usUnited Statesianawiki9pp..us
pamanyungandefpamanyung.anwhois.anNetherlands Antillesianawiki11pp..an
pamaquindefpamaqu.inwhois.inIndiaianawiki8pp..in
pamaquinedefpamaqui.newhois.neNigerianawiki9pp..ne
pamddefpa.mdwhois.mdMoldova, Republic ofianawiki4pp..md
pameladefpame.lawhois.laLao People's Democratic Republicianawiki6pp..la
pamelinadefpameli.nawhois.naNamibiaianawiki8pp..na
pamelladefpamel.lawhois.laLao People's Democratic Republicianawiki7pp..la
pamheaddefpamhe.adwhois.adAndorraianawiki7pp..ad
pamirdefpam.irwhois.irIran, Islamic Republic ofianawiki5pp..ir
pamiriandefpamiri.anwhois.anNetherlands Antillesianawiki8pp..an
pamlicodefpamli.cowhois.coColombiaianawiki7pp..co
pammiedefpamm.iewhois.ieIrelandianawiki6pp..ie
pammydefpam.mywhois.myMalaysiaianawiki5pp..my
pampadefpam.pawhois.paPanamaianawiki5pp..pa
pampangadefpampan.gawhois.gaGabonianawiki8pp..ga
pampangandefpampang.anwhois.anNetherlands Antillesianawiki9pp..an
pampanitodefpampani.towhois.toTongaianawiki9pp..to
pampasdefpamp.aswhois.asAmerican Samoaianawiki6pp..as
pampascatdefpampasc.atwhois.atAustriaianawiki9pp..at
pampascatdefpampas.catwhois.catCatalan languageN/Awiki9pp..cat
pampasdeerdefpampasde.erwhois.erEritreaianawiki10pp..er
pampeandefpampe.anwhois.anNetherlands Antillesianawiki7pp..an
pampelunadefpampelu.nawhois.naNamibiaianawiki9pp..na
pamperdefpamp.erwhois.erEritreaianawiki6pp..er
pampereddarlingdefpampereddarli.ngwhois.ngNigeriaianawiki15pp..ng
pamperedlydefpampered.lywhois.lyLibyan Arab Jamahiriyaianawiki10pp..ly
pampererdefpamper.erwhois.erEritreaianawiki8pp..er
pamperingdefpamperi.ngwhois.ngNigeriaianawiki9pp..ng
pamperodefpampe.rowhois.roRomaniaianawiki7pp..ro
pamphagousdefpamphago.uswhois.usUnited Statesianawiki10pp..us
pamphiliidaedefpamphiliid.aewhois.aeUnited Arab Emiratesianawiki12pp..ae
pamphiliusdefpamphili.uswhois.usUnited Statesianawiki10pp..us
pamphletdefpamphl.etwhois.etEthiopiaianawiki8pp..et
pamphletagedefpamphleta.gewhois.geGeorgiaianawiki11pp..ge
pamphleteerdefpamphlete.erwhois.erEritreaianawiki11pp..er
pamphleterdefpamphlet.erwhois.erEritreaianawiki10pp..er
pamphleticaldefpamphletic.alwhois.alAlbaniaianawiki12pp..al
pamphletizingdefpamphletizi.ngwhois.ngNigeriaianawiki13pp..ng
pamphletwisedefpamphletwi.sewhois.seSwedenianawiki12pp..se
pamphysicaldefpamphysic.alwhois.alAlbaniaianawiki11pp..al
pamphysicismdefpamphysici.smwhois.smSan Marinoianawiki12pp..sm
pamplicodefpampli.cowhois.coColombiaianawiki8pp..co
pamplindefpampl.inwhois.inIndiaianawiki7pp..in
pamplonadefpamplo.nawhois.naNamibiaianawiki8pp..na
pampooteedefpampoot.eewhois.eeEstoniaianawiki9pp..ee
pampootiedefpampoot.iewhois.ieIrelandianawiki9pp..ie
pampredefpamp.rewhois.reReunion Islandianawiki6pp..re
pamprodactylismdefpamprodactyli.smwhois.smSan Marinoianawiki15pp..sm
pamprodactylousdefpamprodactylo.uswhois.usUnited Statesianawiki15pp..us
pampsychismdefpampsychi.smwhois.smSan Marinoianawiki11pp..sm
pampsychistdefpampsychi.stwhois.stSao Tome and Principeianawiki11pp..st
pampuchdefpampu.chwhois.chSwitzerlandianawiki7pp..ch
pamsdefpa.mswhois.msMontserratianawiki4pp..ms
pandefp.anwhois.anNetherlands Antillesianawiki3pp..an
panadefpa.nawhois.naNamibiaianawiki4pp..na
panabasedefpanaba.sewhois.seSwedenianawiki8pp..se
panacadefpana.cawhois.caCanadaianawiki6pp..ca
panaceandefpanace.anwhois.anNetherlands Antillesianawiki8pp..an
panaceasdefpanace.aswhois.asAmerican Samoaianawiki8pp..as
panaceistdefpanacei.stwhois.stSao Tome and Principeianawiki9pp..st
panachesdefpanach.eswhois.esSpainianawiki8pp..es
panachuredefpanachu.rewhois.reReunion Islandianawiki9pp..re
panadasdefpanad.aswhois.asAmerican Samoaianawiki7pp..as
panadedefpana.dewhois.deGermanyianawiki6pp..de
panafricandefpanafric.anwhois.anNetherlands Antillesianawiki10pp..an
panafricanismdefpanafricani.smwhois.smSan Marinoianawiki13pp..sm
panafricanistdefpanafricani.stwhois.stSao Tome and Principeianawiki13pp..st
panafrikanderdefpanafrikand.erwhois.erEritreaianawiki13pp..er
panafrikanderdomdefpanafrikanderd.omwhois.omOmanianawiki16pp..om
panaggiodefpanagg.iowhois.ioBritish Indian Ocean Territoryianawiki8pp..io
panagiasdefpanagi.aswhois.asAmerican Samoaianawiki8pp..as
panamadefpana.mawhois.maMoroccoianawiki6pp..ma
panamacanaldefpanamacan.alwhois.alAlbaniaianawiki11pp..al
panamacanalzonedefpanamacanalzo.newhois.neNigerianawiki15pp..ne
panamadiseasedefpanamadisea.sewhois.seSwedenianawiki13pp..se
panamahatdefpanamah.atwhois.atAustriaianawiki9pp..at
panamaiandefpanamai.anwhois.anNetherlands Antillesianawiki9pp..an
panamaipecacdefpanamaipec.acwhois.acAscension Islandianawiki12pp..ac
panamandefpanam.anwhois.anNetherlands Antillesianawiki7pp..an
panamaniandefpanamani.anwhois.anNetherlands Antillesianawiki10pp..an
panamanodefpanama.nowhois.noNorwayianawiki8pp..no
panamarubberdefpanamarubb.erwhois.erEritreaianawiki12pp..er
panamasdefpanam.aswhois.asAmerican Samoaianawiki7pp..as
panamericadefpanameri.cawhois.caCanadaianawiki10pp..ca
panamericandefpanameric.anwhois.anNetherlands Antillesianawiki11pp..an
panamericanismdefpanamericani.smwhois.smSan Marinoianawiki14pp..sm
panamintdefpanam.intwhois.intInternational Organizationsianawiki8pp..int
panamistdefpanami.stwhois.stSao Tome and Principeianawiki8pp..st
pananglicandefpananglic.anwhois.anNetherlands Antillesianawiki11pp..an
panarabismdefpanarabi.smwhois.smSan Marinoianawiki10pp..sm
panarisdefpanar.iswhois.isIcelandianawiki7pp..is
panaritiumdefpanariti.umwhois.umUnited States Minor Outlying Islandsianawiki10pp..um
panarteritisdefpanarterit.iswhois.isIcelandianawiki12pp..is
panarthritisdefpanarthrit.iswhois.isIcelandianawiki12pp..is
panasianismdefpanasiani.smwhois.smSan Marinoianawiki11pp..sm
panasiaticismdefpanasiatici.smwhois.smSan Marinoianawiki13pp..sm
panateladefpanate.lawhois.laLao People's Democratic Republicianawiki8pp..la
panatelasdefpanatel.aswhois.asAmerican Samoaianawiki9pp..as
panatelladefpanatel.lawhois.laLao People's Democratic Republicianawiki9pp..la
panatellasdefpanatell.aswhois.asAmerican Samoaianawiki10pp..as
panathenaeandefpanathenae.anwhois.anNetherlands Antillesianawiki12pp..an
panatropedefpanatro.pewhois.pePeruianawiki9pp..pe
panaxdefpan.axwhois.axAland Islandsianawiki5pp..ax
panayandefpanay.anwhois.anNetherlands Antillesianawiki7pp..an
panayanodefpanaya.nowhois.noNorwayianawiki8pp..no
panayiotisdefpanayiot.iswhois.isIcelandianawiki10pp..is
panbabyloniandefpanbabyloni.anwhois.anNetherlands Antillesianawiki13pp..an
panbabylonismdefpanbabyloni.smwhois.smSan Marinoianawiki13pp..sm
panboeotiandefpanboeoti.anwhois.anNetherlands Antillesianawiki11pp..an
panboilerdefpanboil.erwhois.erEritreaianawiki9pp..er
panboltdefpanbo.ltwhois.ltLithuaniaianawiki7pp..lt
panbritishdefpanbriti.shwhois.shSaint Helenaianawiki10pp..sh
panbroildefpanbro.ilwhois.ilIsraelianawiki8pp..il
panbroilerdefpanbroil.erwhois.erEritreaianawiki10pp..er
panbroilingdefpanbroili.ngwhois.ngNigeriaianawiki11pp..ng
panbuddhismdefpanbuddhi.smwhois.smSan Marinoianawiki11pp..sm
panbuddhistdefpanbuddhi.stwhois.stSao Tome and Principeianawiki11pp..st
pancakedefpanca.kewhois.keKenyaianawiki7pp..ke
pancakeenginedefpancakeengi.newhois.neNigerianawiki13pp..ne
pancakelandingdefpancakelandi.ngwhois.ngNigeriaianawiki14pp..ng
pancakesdefpancak.eswhois.esSpainianawiki8pp..es
pancakingdefpancaki.ngwhois.ngNigeriaianawiki9pp..ng
pancarditisdefpancardit.iswhois.isIcelandianawiki11pp..is
pancelticismdefpanceltici.smwhois.smSan Marinoianawiki12pp..sm
panchamadefpancha.mawhois.maMoroccoianawiki8pp..ma
panchasiladefpanchasi.lawhois.laLao People's Democratic Republicianawiki10pp..la
panchaxdefpanch.axwhois.axAland Islandsianawiki7pp..ax
panchaxesdefpanchax.eswhois.esSpainianawiki9pp..es
panchayatdefpanchay.atwhois.atAustriaianawiki9pp..at
panchayetdefpanchay.etwhois.etEthiopiaianawiki9pp..et
panchenlamadefpanchenla.mawhois.maMoroccoianawiki11pp..ma
panchinadefpanchi.nawhois.naNamibiaianawiki8pp..na
panchitodefpanchi.towhois.toTongaianawiki8pp..to
panchristiandefpanchristi.anwhois.anNetherlands Antillesianawiki12pp..an
panchromatismdefpanchromati.smwhois.smSan Marinoianawiki13pp..sm
panconveyerdefpanconvey.erwhois.erEritreaianawiki11pp..er
pancosmismdefpancosmi.smwhois.smSan Marinoianawiki10pp..sm
pancosmistdefpancosmi.stwhois.stSao Tome and Principeianawiki10pp..st
pancratiandefpancrati.anwhois.anNetherlands Antillesianawiki10pp..an
pancratiastdefpancratia.stwhois.stSao Tome and Principeianawiki11pp..st
pancraticaldefpancratic.alwhois.alAlbaniaianawiki11pp..al
pancraticallydefpancratical.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
pancratisdefpancrat.iswhois.isIcelandianawiki9pp..is
pancratismdefpancrati.smwhois.smSan Marinoianawiki10pp..sm
pancratistdefpancrati.stwhois.stSao Tome and Principeianawiki10pp..st
pancratiumdefpancrati.umwhois.umUnited States Minor Outlying Islandsianawiki10pp..um
pancreasdefpancre.aswhois.asAmerican Samoaianawiki8pp..as
pancreasesdefpancreas.eswhois.esSpainianawiki10pp..es
pancreasptyalindefpancreasptyal.inwhois.inIndiaianawiki15pp..in
pancreatdefpancre.atwhois.atAustriaianawiki8pp..at
pancreatectomydefpancreatecto.mywhois.myMalaysiaianawiki14pp..my
pancreatemphraxisdefpancreatemphrax.iswhois.isIcelandianawiki17pp..is
pancreathelcosisdefpancreathelcos.iswhois.isIcelandianawiki16pp..is
pancreaticfibrosisdefpancreaticfibros.iswhois.isIcelandianawiki18pp..is
pancreaticoduodenaldefpancreaticoduoden.alwhois.alAlbaniaianawiki19pp..al
pancreaticoduodenostomydefpancreaticoduodenosto.mywhois.myMalaysiaianawiki23pp..my
pancreaticogastrostomydefpancreaticogastrosto.mywhois.myMalaysiaianawiki22pp..my
pancreatindefpancreat.inwhois.inIndiaianawiki10pp..in
pancreatismdefpancreati.smwhois.smSan Marinoianawiki11pp..sm
pancreatitisdefpancreatit.iswhois.isIcelandianawiki12pp..is
pancreatoduodenectomydefpancreatoduodenecto.mywhois.myMalaysiaianawiki21pp..my
pancreatoenterostomydefpancreatoenterosto.mywhois.myMalaysiaianawiki20pp..my
pancreatogenousdefpancreatogeno.uswhois.usUnited Statesianawiki15pp..us
pancreatoiddefpancreato.idwhois.idIndonesiaianawiki11pp..id
pancreatolipasedefpancreatolipa.sewhois.seSwedenianawiki15pp..se
pancreatolithdefpancreatoli.thwhois.thThailandianawiki13pp..th
pancreatomydefpancreato.mywhois.myMalaysiaianawiki11pp..my
pancreatoncusdefpancreatonc.uswhois.usUnited Statesianawiki13pp..us
pancreatotomiesdefpancreatotomi.eswhois.esSpainianawiki15pp..es
pancreatotomydefpancreatoto.mywhois.myMalaysiaianawiki13pp..my
pancreectomydefpancreecto.mywhois.myMalaysiaianawiki12pp..my
pancreozymindefpancreozym.inwhois.inIndiaianawiki12pp..in
pancroatdefpancro.atwhois.atAustriaianawiki8pp..at
pancuroniumbromidedefpancuroniumbromi.dewhois.deGermanyianawiki18pp..de
pandacardefpandac.arwhois.arArgentinaianawiki8pp..ar
pandaldefpand.alwhois.alAlbaniaianawiki6pp..al
pandandefpand.anwhois.anNetherlands Antillesianawiki6pp..an
pandanaceaedefpandanace.aewhois.aeUnited Arab Emiratesianawiki11pp..ae
pandanaceousdefpandanaceo.uswhois.usUnited Statesianawiki12pp..us
pandanalesdefpandanal.eswhois.esSpainianawiki10pp..es
pandanidefpanda.niwhois.niNicaraguaianawiki7pp..ni
pandanusdefpandan.uswhois.usUnited Statesianawiki8pp..us
pandanusesdefpandanus.eswhois.esSpainianawiki10pp..es
pandardefpand.arwhois.arArgentinaianawiki6pp..ar
pandaramdefpandar.amwhois.amArmeniaianawiki8pp..am
pandareusdefpandare.uswhois.usUnited Statesianawiki9pp..us
pandarusdefpandar.uswhois.usUnited Statesianawiki8pp..us
pandasdefpand.aswhois.asAmerican Samoaianawiki6pp..as
pandavadefpanda.vawhois.vaHoly See (Vatican City State)ianawiki7pp..va
pandavasdefpandav.aswhois.asAmerican Samoaianawiki8pp..as
pandeandefpande.anwhois.anNetherlands Antillesianawiki7pp..an
pandeanpipedefpandeanpi.pewhois.pePeruianawiki11pp..pe
pandeanpipesdefpandeanpip.eswhois.esSpainianawiki12pp..es
pandectistdefpandecti.stwhois.stSao Tome and Principeianawiki10pp..st
pandemiandefpandemi.anwhois.anNetherlands Antillesianawiki9pp..an
pandemicdiseasedefpandemicdisea.sewhois.seSwedenianawiki15pp..se
pandemicsdefpandemi.cswhois.csSerbia and Montenegroianawiki9pp..cs
pandemoniacdefpandemoni.acwhois.acAscension Islandianawiki11pp..ac
pandemoniacaldefpandemoniac.alwhois.alAlbaniaianawiki13pp..al
pandemoniandefpandemoni.anwhois.anNetherlands Antillesianawiki11pp..an
pandemonismdefpandemoni.smwhois.smSan Marinoianawiki11pp..sm
pandemoniumdefpandemoni.umwhois.umUnited States Minor Outlying Islandsianawiki11pp..um
pandemoniumsdefpandemoniu.mswhois.msMontserratianawiki12pp..ms
pandemydefpande.mywhois.myMalaysiaianawiki7pp..my
pandenominationaldefpandenomination.alwhois.alAlbaniaianawiki17pp..al
panderdefpand.erwhois.erEritreaianawiki6pp..er
panderagedefpandera.gewhois.geGeorgiaianawiki9pp..ge
pandererdefpander.erwhois.erEritreaianawiki8pp..er
panderingdefpanderi.ngwhois.ngNigeriaianawiki9pp..ng
panderismdefpanderi.smwhois.smSan Marinoianawiki9pp..sm
panderlydefpander.lywhois.lyLibyan Arab Jamahiriyaianawiki8pp..ly
pandermadefpander.mawhois.maMoroccoianawiki8pp..ma
panderousdefpandero.uswhois.usUnited Statesianawiki9pp..us
pandertodefpander.towhois.toTongaianawiki8pp..to
pandiabolismdefpandiaboli.smwhois.smSan Marinoianawiki12pp..sm
pandichdefpandi.chwhois.chSwitzerlandianawiki7pp..ch
pandiesdefpandi.eswhois.esSpainianawiki7pp..es
pandionidaedefpandionid.aewhois.aeUnited Arab Emiratesianawiki11pp..ae
pandiontheyoungerdefpandiontheyoung.erwhois.erEritreaianawiki17pp..er
panditdefpand.itwhois.itItalyianawiki6pp..it
pandolfidefpandol.fiwhois.fiFinlandianawiki8pp..fi
pandoraefretumdefpandoraefret.umwhois.umUnited States Minor Outlying Islandsianawiki14pp..um
pandorasdefpandor.aswhois.asAmerican Samoaianawiki8pp..as
pandoredefpando.rewhois.reReunion Islandianawiki7pp..re
pandoresdefpandor.eswhois.esSpainianawiki8pp..es
pandoridaedefpandorid.aewhois.aeUnited Arab Emiratesianawiki10pp..ae
pandorinadefpandori.nawhois.naNamibiaianawiki9pp..na
pandostodefpandos.towhois.toTongaianawiki8pp..to
pandowdiesdefpandowdi.eswhois.esSpainianawiki10pp..es
pandurasdefpandur.aswhois.asAmerican Samoaianawiki8pp..as
panduredefpandu.rewhois.reReunion Islandianawiki7pp..re
pandybatdefpandyb.atwhois.atAustriaianawiki8pp..at
pandyingdefpandyi.ngwhois.ngNigeriaianawiki8pp..ng
panedefpa.newhois.neNigerianawiki4pp..ne
panecclesiasticaldefpanecclesiastic.alwhois.alAlbaniaianawiki17pp..al
panegoismdefpanegoi.smwhois.smSan Marinoianawiki9pp..sm
panegoistdefpanegoi.stwhois.stSao Tome and Principeianawiki9pp..st
panegyredefpanegy.rewhois.reReunion Islandianawiki8pp..re
panegyricadefpanegyri.cawhois.caCanadaianawiki10pp..ca
panegyricaldefpanegyric.alwhois.alAlbaniaianawiki11pp..al
panegyricallydefpanegyrical.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
panegyricsdefpanegyri.cswhois.csSerbia and Montenegroianawiki10pp..cs
panegyricumdefpanegyric.umwhois.umUnited States Minor Outlying Islandsianawiki11pp..um
panegyrisdefpanegyr.iswhois.isIcelandianawiki9pp..is
panegyristdefpanegyri.stwhois.stSao Tome and Principeianawiki10pp..st
panegyrizerdefpanegyriz.erwhois.erEritreaianawiki11pp..er
panegyrizesdefpanegyriz.eswhois.esSpainianawiki11pp..es
panegyrizingdefpanegyrizi.ngwhois.ngNigeriaianawiki12pp..ng
paneladefpane.lawhois.laLao People's Democratic Republicianawiki6pp..la
panelbeaterdefpanelbeat.erwhois.erEritreaianawiki11pp..er
panelerdefpanel.erwhois.erEritreaianawiki7pp..er
panelheatingdefpanelheati.ngwhois.ngNigeriaianawiki12pp..ng
panelhousedefpanelhou.sewhois.seSwedenianawiki10pp..se
panelingdefpaneli.ngwhois.ngNigeriaianawiki8pp..ng
panelingsdefpanelin.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki9pp..gs
panelistdefpaneli.stwhois.stSao Tome and Principeianawiki8pp..st
panellengthdefpanelleng.thwhois.thThailandianawiki11pp..th
panellightingdefpanellighti.ngwhois.ngNigeriaianawiki13pp..ng
panellingdefpanelli.ngwhois.ngNigeriaianawiki9pp..ng
panellistdefpanelli.stwhois.stSao Tome and Principeianawiki9pp..st
panelpatchdefpanelpat.chwhois.chSwitzerlandianawiki10pp..ch
panelphotographdefpanelphotogra.phwhois.phPhilippinesianawiki15pp..ph
panelpindefpanelp.inwhois.inIndiaianawiki8pp..in
panelplanedefpanelpla.newhois.neNigerianawiki10pp..ne
panelpointdefpanelpo.intwhois.intInternational Organizationsianawiki10pp..int
panelsdefpane.lswhois.lsLesothoianawiki6pp..ls
panelsawdefpanels.awwhois.awArubaianawiki8pp..aw
panelswitchingdefpanelswitchi.ngwhois.ngNigeriaianawiki14pp..ng
paneltruckdefpaneltru.ckwhois.ckCook Islandsianawiki10pp..ck
panelvandefpanelv.anwhois.anNetherlands Antillesianawiki8pp..an
panelwisedefpanelwi.sewhois.seSwedenianawiki9pp..se
panentheismdefpanenthei.smwhois.smSan Marinoianawiki11pp..sm
panesdefpan.eswhois.esSpainianawiki5pp..es
paneteladefpanete.lawhois.laLao People's Democratic Republicianawiki8pp..la
panetelasdefpanetel.aswhois.asAmerican Samoaianawiki9pp..as
panetelladefpanetel.lawhois.laLao People's Democratic Republicianawiki9pp..la
panetieredefpanetie.rewhois.reReunion Islandianawiki9pp..re
panettonedefpanetto.newhois.neNigerianawiki9pp..ne
panettonesdefpanetton.eswhois.esSpainianawiki10pp..es
panettonidefpanetto.niwhois.niNicaraguaianawiki9pp..ni
paneulogismdefpaneulogi.smwhois.smSan Marinoianawiki11pp..sm
paneuropedefpaneuro.pewhois.pePeruianawiki9pp..pe
paneuropeandefpaneurope.anwhois.anNetherlands Antillesianawiki11pp..an
panfildefpanf.ilwhois.ilIsraelianawiki6pp..il
panfishdefpanfi.shwhois.shSaint Helenaianawiki7pp..sh
panfishesdefpanfish.eswhois.esSpainianawiki9pp..es
panfriesdefpanfri.eswhois.esSpainianawiki8pp..es
panfryingdefpanfryi.ngwhois.ngNigeriaianawiki9pp..ng
panfulsdefpanfu.lswhois.lsLesothoianawiki7pp..ls
pangdefpa.ngwhois.ngNigeriaianawiki4pp..ng
pangadefpan.gawhois.gaGabonianawiki5pp..ga
pangamousdefpangamo.uswhois.usUnited Statesianawiki9pp..us
pangamouslydefpangamous.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
pangamydefpanga.mywhois.myMalaysiaianawiki7pp..my
panganedefpanga.newhois.neNigerianawiki7pp..ne
pangarodefpanga.rowhois.roRomaniaianawiki7pp..ro
pangasdefpang.aswhois.asAmerican Samoaianawiki6pp..as
pangasidefpanga.siwhois.siSloveniaianawiki7pp..si
pangasinandefpangasin.anwhois.anNetherlands Antillesianawiki10pp..an
pangenedefpange.newhois.neNigerianawiki7pp..ne
pangenesdefpangen.eswhois.esSpainianawiki8pp..es
pangenesisdefpangenes.iswhois.isIcelandianawiki10pp..is
pangeneticallydefpangenetical.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
pangerangdefpangera.ngwhois.ngNigeriaianawiki9pp..ng
pangermandefpangerm.anwhois.anNetherlands Antillesianawiki9pp..an
pangermanismdefpangermani.smwhois.smSan Marinoianawiki12pp..sm
pangermanistdefpangermani.stwhois.stSao Tome and Principeianawiki12pp..st
pangidefpan.giwhois.giGibraltarianawiki5pp..gi
pangingdefpangi.ngwhois.ngNigeriaianawiki7pp..ng
pangiumdefpangi.umwhois.umUnited States Minor Outlying Islandsianawiki7pp..um
panglesslydefpangless.lywhois.lyLibyan Arab Jamahiriyaianawiki10pp..ly
panglimadefpangli.mawhois.maMoroccoianawiki8pp..ma
panglossiandefpanglossi.anwhois.anNetherlands Antillesianawiki11pp..an
pangolindefpangol.inwhois.inIndiaianawiki8pp..in
pangrammatistdefpangrammati.stwhois.stSao Tome and Principeianawiki13pp..st
pangravedefpangra.vewhois.veVenezuelaianawiki8pp..ve
pangsdefpan.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki5pp..gs
panguitchdefpanguit.chwhois.chSwitzerlandianawiki9pp..ch
pangyricaldefpangyric.alwhois.alAlbaniaianawiki10pp..al
panhandlerdefpanhandl.erwhois.erEritreaianawiki10pp..er
panhandlesdefpanhandl.eswhois.esSpainianawiki10pp..es
panhandlingdefpanhandli.ngwhois.ngNigeriaianawiki11pp..ng
panhasdefpanh.aswhois.asAmerican Samoaianawiki6pp..as
panheaddefpanhe.adwhois.adAndorraianawiki7pp..ad
panhellenismdefpanhelleni.smwhois.smSan Marinoianawiki12pp..sm
panhellenistdefpanhelleni.stwhois.stSao Tome and Principeianawiki12pp..st
panhelleniumdefpanhelleni.umwhois.umUnited States Minor Outlying Islandsianawiki12pp..um
panhidrosisdefpanhidros.iswhois.isIcelandianawiki11pp..is
panhispanismdefpanhispani.smwhois.smSan Marinoianawiki12pp..sm
panhumandefpanhum.anwhois.anNetherlands Antillesianawiki8pp..an
panhygrousdefpanhygro.uswhois.usUnited Statesianawiki10pp..us
panhypopituitarismdefpanhypopituitari.smwhois.smSan Marinoianawiki18pp..sm
panhysterectomydefpanhysterecto.mywhois.myMalaysiaianawiki15pp..my
panidefpa.niwhois.niNicaraguaianawiki4pp..ni
panicaldefpanic.alwhois.alAlbaniaianawiki7pp..al
panicallydefpanical.lywhois.lyLibyan Arab Jamahiriyaianawiki9pp..ly
panicbardefpanicb.arwhois.arArgentinaianawiki8pp..ar
panicboltdefpanicbo.ltwhois.ltLithuaniaianawiki9pp..lt
panicfeardefpanicfe.arwhois.arArgentinaianawiki9pp..ar
panichthyophagousdefpanichthyophago.uswhois.usUnited Statesianawiki17pp..us
panickierdefpanicki.erwhois.erEritreaianawiki9pp..er
panickiestdefpanickie.stwhois.stSao Tome and Principeianawiki10pp..st
panickingdefpanicki.ngwhois.ngNigeriaianawiki9pp..ng
panickydefpanic.kywhois.kyCayman Islandsianawiki7pp..ky
paniclesdefpanicl.eswhois.esSpainianawiki8pp..es
paniclikedefpanicli.kewhois.keKenyaianawiki9pp..ke
panicmongerdefpanicmong.erwhois.erEritreaianawiki11pp..er
panicmongeringdefpanicmongeri.ngwhois.ngNigeriaianawiki14pp..ng
paniconographdefpaniconogra.phwhois.phPhilippinesianawiki13pp..ph
panicpronedefpanicpro.newhois.neNigerianawiki10pp..ne
panicsdefpani.cswhois.csSerbia and Montenegroianawiki6pp..cs
panicstrikedefpanicstri.kewhois.keKenyaianawiki11pp..ke
panicstruckdefpanicstru.ckwhois.ckCook Islandsianawiki11pp..ck
paniculatelydefpaniculate.lywhois.lyLibyan Arab Jamahiriyaianawiki12pp..ly
paniculitisdefpaniculit.iswhois.isIcelandianawiki11pp..is
panicumdefpanic.umwhois.umUnited States Minor Outlying Islandsianawiki7pp..um
panicumsdefpanicu.mswhois.msMontserratianawiki8pp..ms
panidrosisdefpanidros.iswhois.isIcelandianawiki10pp..is
panierdefpani.erwhois.erEritreaianawiki6pp..er
panineandefpanine.anwhois.anNetherlands Antillesianawiki8pp..an
paninidefpani.niwhois.niNicaraguaianawiki6pp..ni
panioniandefpanioni.anwhois.anNetherlands Antillesianawiki9pp..an
panipatdefpanip.atwhois.atAustriaianawiki7pp..at
paniquitandefpaniquit.anwhois.anNetherlands Antillesianawiki10pp..an
paniscdefpani.scwhois.scSeychellesianawiki6pp..sc
paniscadefpanis.cawhois.caCanadaianawiki7pp..ca
paniscusdefpanisc.uswhois.usUnited Statesianawiki8pp..us
paniskdefpani.skwhois.skSlovak Republicianawiki6pp..sk
panislamdefpanisl.amwhois.amArmeniaianawiki8pp..am
panislamismdefpanislami.smwhois.smSan Marinoianawiki11pp..sm
panislamistdefpanislami.stwhois.stSao Tome and Principeianawiki11pp..st
panisraelitishdefpanisraeliti.shwhois.shSaint Helenaianawiki14pp..sh
panivorousdefpanivoro.uswhois.usUnited Statesianawiki10pp..us
panjabidefpanja.biwhois.biBurundiianawiki7pp..bi
panjandrumdefpanjandr.umwhois.umUnited States Minor Outlying Islandsianawiki10pp..um
panjandrumsdefpanjandru.mswhois.msMontserratianawiki11pp..ms
panjimdefpanj.imwhois.imIsle of Manianawiki6pp..im
pankhurstdefpankhur.stwhois.stSao Tome and Principeianawiki9pp..st
pankindefpank.inwhois.inIndiaianawiki6pp..in
panlatindefpanlat.inwhois.inIndiaianawiki8pp..in
panlatinistdefpanlatini.stwhois.stSao Tome and Principeianawiki11pp..st
panleafdefpanle.afwhois.afAfghanistanianawiki7pp..af
panloafdefpanlo.afwhois.afAfghanistanianawiki7pp..af
panlogicaldefpanlogic.alwhois.alAlbaniaianawiki10pp..al
panlogismdefpanlogi.smwhois.smSan Marinoianawiki9pp..sm
panlogistdefpanlogi.stwhois.stSao Tome and Principeianawiki9pp..st
panlogisticaldefpanlogistic.alwhois.alAlbaniaianawiki13pp..al
panlogisticallydefpanlogistical.lywhois.lyLibyan Arab Jamahiriyaianawiki15pp..ly
panmandefpanm.anwhois.anNetherlands Antillesianawiki6pp..an
panmerismdefpanmeri.smwhois.smSan Marinoianawiki9pp..sm
panmixesdefpanmix.eswhois.esSpainianawiki8pp..es
panmixiasdefpanmixi.aswhois.asAmerican Samoaianawiki9pp..as
panmixisdefpanmix.iswhois.isIcelandianawiki8pp..is
panmongoliandefpanmongoli.anwhois.anNetherlands Antillesianawiki12pp..an
panmongolismdefpanmongoli.smwhois.smSan Marinoianawiki12pp..sm
panmoslemismdefpanmoslemi.smwhois.smSan Marinoianawiki12pp..sm
panmugdefpanm.ugwhois.ugUgandaianawiki6pp..ug
panmunjomdefpanmunj.omwhois.omOmanianawiki9pp..om
panmyelophthisisdefpanmyelophthis.iswhois.isIcelandianawiki16pp..is
pannadefpan.nawhois.naNamibiaianawiki5pp..na
pannadedefpanna.dewhois.deGermanyianawiki7pp..de
pannagdefpann.agwhois.agAntigua and Barbudaianawiki6pp..ag
pannagedefpanna.gewhois.geGeorgiaianawiki7pp..ge
pannamdefpann.amwhois.amArmeniaianawiki6pp..am
pannationalismdefpannationali.smwhois.smSan Marinoianawiki14pp..sm
pannedefpan.newhois.neNigerianawiki5pp..ne
pannerdefpann.erwhois.erEritreaianawiki6pp..er
pannesdefpann.eswhois.esSpainianawiki6pp..es
panneuritisdefpanneurit.iswhois.isIcelandianawiki11pp..is
pannevelvetdefpannevelv.etwhois.etEthiopiaianawiki11pp..et
panniculardefpannicul.arwhois.arArgentinaianawiki10pp..ar
panniculitisdefpanniculit.iswhois.isIcelandianawiki12pp..is
panniculusdefpannicul.uswhois.usUnited Statesianawiki10pp..us
pannierdefpanni.erwhois.erEritreaianawiki7pp..er
panniermandefpannierm.anwhois.anNetherlands Antillesianawiki10pp..an
pannierpackdefpannierpa.ckwhois.ckCook Islandsianawiki11pp..ck
pannikindefpannik.inwhois.inIndiaianawiki8pp..in
panningdefpanni.ngwhois.ngNigeriaianawiki7pp..ng
panninidefpanni.niwhois.niNicaraguaianawiki7pp..ni
pannoniandefpannoni.anwhois.anNetherlands Antillesianawiki9pp..an
pannosedefpanno.sewhois.seSwedenianawiki7pp..se
pannoselydefpannose.lywhois.lyLibyan Arab Jamahiriyaianawiki9pp..ly
pannumdefpann.umwhois.umUnited States Minor Outlying Islandsianawiki6pp..um
pannusdefpann.uswhois.usUnited Statesianawiki6pp..us
pannuscoriumdefpannuscori.umwhois.umUnited States Minor Outlying Islandsianawiki12pp..um
panoandefpano.anwhois.anNetherlands Antillesianawiki6pp..an
panochasdefpanoch.aswhois.asAmerican Samoaianawiki8pp..as
panochesdefpanoch.eswhois.esSpainianawiki8pp..es
panococodefpanoco.cowhois.coColombiaianawiki8pp..co
panofskydefpanofs.kywhois.kyCayman Islandsianawiki8pp..ky
panoladefpano.lawhois.laLao People's Democratic Republicianawiki6pp..la
panoliadeerdefpanoliade.erwhois.erEritreaianawiki11pp..er
panomphaeandefpanomphae.anwhois.anNetherlands Antillesianawiki11pp..an
panomphaeusdefpanomphae.uswhois.usUnited Statesianawiki11pp..us
panompheandefpanomphe.anwhois.anNetherlands Antillesianawiki10pp..an
panopeusdefpanope.uswhois.usUnited Statesianawiki8pp..us
panophthalmitisdefpanophthalmit.iswhois.isIcelandianawiki15pp..is
panopliesdefpanopli.eswhois.esSpainianawiki9pp..es
panoplistdefpanopli.stwhois.stSao Tome and Principeianawiki9pp..st
panoplydefpanop.lywhois.lyLibyan Arab Jamahiriyaianawiki7pp..ly
panoplyingdefpanoplyi.ngwhois.ngNigeriaianawiki10pp..ng
panoptesdefpanopt.eswhois.esSpainianawiki8pp..es
panopticaldefpanoptic.alwhois.alAlbaniaianawiki10pp..al
panoramdefpanor.amwhois.amArmeniaianawiki7pp..am
panoramadefpanora.mawhois.maMoroccoianawiki8pp..ma
panoramasdefpanoram.aswhois.asAmerican Samoaianawiki9pp..as
panoramicaldefpanoramic.alwhois.alAlbaniaianawiki11pp..al
panoramicallydefpanoramical.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
panoramicradardefpanoramicrad.arwhois.arArgentinaianawiki14pp..ar
panoramicsightdefpanoramicsig.htwhois.htHaitiianawiki14pp..ht
panoramictelescopedefpanoramictelesco.pewhois.pePeruianawiki18pp..pe
panoramistdefpanorami.stwhois.stSao Tome and Principeianawiki10pp..st
panorpadefpanor.pawhois.paPanamaianawiki7pp..pa
panorpataedefpanorpat.aewhois.aeUnited Arab Emiratesianawiki10pp..ae
panorpiandefpanorpi.anwhois.anNetherlands Antillesianawiki9pp..an
panorpiddefpanorp.idwhois.idIndonesiaianawiki8pp..id
panorpidaedefpanorpid.aewhois.aeUnited Arab Emiratesianawiki10pp..ae
panosteitisdefpanosteit.iswhois.isIcelandianawiki11pp..is
panostitisdefpanostit.iswhois.isIcelandianawiki10pp..is
panotitisdefpanotit.iswhois.isIcelandianawiki9pp..is
panotypedefpanoty.pewhois.pePeruianawiki8pp..pe
panowiedefpanow.iewhois.ieIrelandianawiki7pp..ie
panphenomenalismdefpanphenomenali.smwhois.smSan Marinoianawiki16pp..sm
panpipedefpanpi.pewhois.pePeruianawiki7pp..pe
panpipesdefpanpip.eswhois.esSpainianawiki8pp..es
panpneumatismdefpanpneumati.smwhois.smSan Marinoianawiki13pp..sm
panpolismdefpanpoli.smwhois.smSan Marinoianawiki9pp..sm
panpresbyteriandefpanpresbyteri.anwhois.anNetherlands Antillesianawiki15pp..an
panprussianismdefpanprussiani.smwhois.smSan Marinoianawiki14pp..sm
panpsychismdefpanpsychi.smwhois.smSan Marinoianawiki11pp..sm
panpsychistdefpanpsychi.stwhois.stSao Tome and Principeianawiki11pp..st
panrussiandefpanrussi.anwhois.anNetherlands Antillesianawiki10pp..an
pansatanismdefpansatani.smwhois.smSan Marinoianawiki11pp..sm
panscandinaviandefpanscandinavi.anwhois.anNetherlands Antillesianawiki15pp..an
panscientistdefpanscienti.stwhois.stSao Tome and Principeianawiki12pp..st
pansciolismdefpanscioli.smwhois.smSan Marinoianawiki11pp..sm
pansciolistdefpanscioli.stwhois.stSao Tome and Principeianawiki11pp..st
pansclavismdefpansclavi.smwhois.smSan Marinoianawiki11pp..sm
pansclavistdefpansclavi.stwhois.stSao Tome and Principeianawiki11pp..st
pansclavoniandefpansclavoni.anwhois.anNetherlands Antillesianawiki13pp..an
pansclerosisdefpanscleros.iswhois.isIcelandianawiki12pp..is
pansedefpan.sewhois.seSwedenianawiki5pp..se
pansexismdefpansexi.smwhois.smSan Marinoianawiki9pp..sm
pansexualdefpansexu.alwhois.alAlbaniaianawiki9pp..al
pansexualismdefpansexuali.smwhois.smSan Marinoianawiki12pp..sm
pansexualistdefpansexuali.stwhois.stSao Tome and Principeianawiki12pp..st
pansidedefpansi.dewhois.deGermanyianawiki7pp..de
pansidemandefpansidem.anwhois.anNetherlands Antillesianawiki10pp..an
pansiedefpans.iewhois.ieIrelandianawiki6pp..ie
pansieredefpansie.rewhois.reReunion Islandianawiki8pp..re
pansiesdefpansi.eswhois.esSpainianawiki7pp..es
pansildefpans.ilwhois.ilIsraelianawiki6pp..il
pansinuitisdefpansinuit.iswhois.isIcelandianawiki11pp..is
pansinusitisdefpansinusit.iswhois.isIcelandianawiki12pp..is
pansirdefpans.irwhois.irIran, Islamic Republic ofianawiki6pp..ir
pansitdefpans.itwhois.itItalyianawiki6pp..it
panslavismdefpanslavi.smwhois.smSan Marinoianawiki10pp..sm
panslavistdefpanslavi.stwhois.stSao Tome and Principeianawiki10pp..st
panslavoniandefpanslavoni.anwhois.anNetherlands Antillesianawiki12pp..an
panslavonismdefpanslavoni.smwhois.smSan Marinoianawiki12pp..sm
pansmithdefpansmi.thwhois.thThailandianawiki8pp..th
pansophicaldefpansophic.alwhois.alAlbaniaianawiki11pp..al
pansophicallydefpansophical.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
pansophiesdefpansophi.eswhois.esSpainianawiki10pp..es
pansophismdefpansophi.smwhois.smSan Marinoianawiki10pp..sm
pansophistdefpansophi.stwhois.stSao Tome and Principeianawiki10pp..st
panspermatismdefpanspermati.smwhois.smSan Marinoianawiki13pp..sm
panspermatistdefpanspermati.stwhois.stSao Tome and Principeianawiki13pp..st
panspermismdefpanspermi.smwhois.smSan Marinoianawiki11pp..sm
panspermistdefpanspermi.stwhois.stSao Tome and Principeianawiki11pp..st
panspermydefpansper.mywhois.myMalaysiaianawiki9pp..my
pansphygmographdefpansphygmogra.phwhois.phPhilippinesianawiki15pp..ph
panspipesdefpanspip.eswhois.esSpainianawiki9pp..es
panstereoramadefpanstereora.mawhois.maMoroccoianawiki13pp..ma
pansydefpan.sywhois.sySyrian Arab Republicianawiki5pp..sy
pansygrowingdefpansygrowi.ngwhois.ngNigeriaianawiki12pp..ng
pansyishdefpansyi.shwhois.shSaint Helenaianawiki8pp..sh
pansylikedefpansyli.kewhois.keKenyaianawiki9pp..ke
pansyorchiddefpansyorch.idwhois.idIndonesiaianawiki11pp..id
pansyriandefpansyri.anwhois.anNetherlands Antillesianawiki9pp..an
pansyvioletdefpansyviol.etwhois.etEthiopiaianawiki11pp..et
pantacosmdefpantaco.smwhois.smSan Marinoianawiki9pp..sm
pantafterdefpantaft.erwhois.erEritreaianawiki9pp..er
pantagamydefpantaga.mywhois.myMalaysiaianawiki9pp..my
pantagraphdefpantagra.phwhois.phPhilippinesianawiki10pp..ph
pantagraphicaldefpantagraphic.alwhois.alAlbaniaianawiki14pp..al
pantagrueliandefpantagrueli.anwhois.anNetherlands Antillesianawiki13pp..an
pantagruelicallydefpantagruelical.lywhois.lyLibyan Arab Jamahiriyaianawiki16pp..ly
pantagruelinedefpantagrueli.newhois.neNigerianawiki13pp..ne
pantagruelismdefpantagrueli.smwhois.smSan Marinoianawiki13pp..sm
pantagruelistdefpantagrueli.stwhois.stSao Tome and Principeianawiki13pp..st
pantagruelisticaldefpantagruelistic.alwhois.alAlbaniaianawiki17pp..al
pantalandefpantal.anwhois.anNetherlands Antillesianawiki8pp..an
pantaletdefpantal.etwhois.etEthiopiaianawiki8pp..et
pantalettesdefpantalett.eswhois.esSpainianawiki11pp..es
pantalonedefpantalo.newhois.neNigerianawiki9pp..ne
pantameterdefpantamet.erwhois.erEritreaianawiki10pp..er
pantamorphdefpantamor.phwhois.phPhilippinesianawiki10pp..ph
pantanemonedefpantanemo.newhois.neNigerianawiki11pp..ne
pantarbedefpantar.bewhois.beBelgiumianawiki8pp..be
pantasdefpant.aswhois.asAmerican Samoaianawiki6pp..as
pantascopedefpantasco.pewhois.pePeruianawiki10pp..pe
pantastominadefpantastomi.nawhois.naNamibiaianawiki12pp..na
pantatypedefpantaty.pewhois.pePeruianawiki9pp..pe
pantechniconvandefpantechniconv.anwhois.anNetherlands Antillesianawiki15pp..an
pantelegraphdefpantelegra.phwhois.phPhilippinesianawiki12pp..ph
panteleologismdefpanteleologi.smwhois.smSan Marinoianawiki14pp..sm
pantelephonedefpantelepho.newhois.neNigerianawiki12pp..ne
panterdefpant.erwhois.erEritreaianawiki6pp..er
pantererdefpanter.erwhois.erEritreaianawiki8pp..er
panteutonismdefpanteutoni.smwhois.smSan Marinoianawiki12pp..sm
pantheasdefpanthe.aswhois.asAmerican Samoaianawiki8pp..as
pantheiandefpanthei.anwhois.anNetherlands Antillesianawiki9pp..an
pantheismdefpanthei.smwhois.smSan Marinoianawiki9pp..sm
pantheistdefpanthei.stwhois.stSao Tome and Principeianawiki9pp..st
pantheisticaldefpantheistic.alwhois.alAlbaniaianawiki13pp..al
pantheisticallydefpantheistical.lywhois.lyLibyan Arab Jamahiriyaianawiki15pp..ly
panthelematismdefpanthelemati.smwhois.smSan Marinoianawiki14pp..sm
panthelismdefpantheli.smwhois.smSan Marinoianawiki10pp..sm
pantheologistdefpantheologi.stwhois.stSao Tome and Principeianawiki13pp..st
pantheologydefpantheolo.gywhois.gyGuyanaianawiki11pp..gy
pantherdefpanth.erwhois.erEritreaianawiki7pp..er
panthercatdefpantherc.atwhois.atAustriaianawiki10pp..at
panthercatdefpanther.catwhois.catCatalan languageN/Awiki10pp..cat
panthercowriedefpanthercowr.iewhois.ieIrelandianawiki13pp..ie
pantherinedefpantheri.newhois.neNigerianawiki10pp..ne
pantherishdefpantheri.shwhois.shSaint Helenaianawiki10pp..sh
pantherlikedefpantherli.kewhois.keKenyaianawiki11pp..ke
pantherlilydefpantherli.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
pantheumdefpanthe.umwhois.umUnited States Minor Outlying Islandsianawiki8pp..um
panthousdefpantho.uswhois.usUnited Statesianawiki8pp..us
pantiedefpant.iewhois.ieIrelandianawiki6pp..ie
pantiesdefpanti.eswhois.esSpainianawiki7pp..es
pantihosedefpantiho.sewhois.seSwedenianawiki9pp..se
pantilelathdefpantilela.thwhois.thThailandianawiki11pp..th
pantilesdefpantil.eswhois.esSpainianawiki8pp..es
pantilingdefpantili.ngwhois.ngNigeriaianawiki9pp..ng
pantindefpant.inwhois.inIndiaianawiki6pp..in
pantinedefpanti.newhois.neNigerianawiki7pp..ne
pantingdefpanti.ngwhois.ngNigeriaianawiki7pp..ng
pantinglydefpanting.lywhois.lyLibyan Arab Jamahiriyaianawiki9pp..ly
pantingstringerdefpantingstring.erwhois.erEritreaianawiki15pp..er
pantisocracydefpantisocra.cywhois.cyCyprusianawiki12pp..cy
pantisocratdefpantisocr.atwhois.atAustriaianawiki11pp..at
pantisocraticaldefpantisocratic.alwhois.alAlbaniaianawiki15pp..al
pantisocratistdefpantisocrati.stwhois.stSao Tome and Principeianawiki14pp..st
pantlerdefpantl.erwhois.erEritreaianawiki7pp..er
pantodefpan.towhois.toTongaianawiki5pp..to
pantocaindefpantoca.inwhois.inIndiaianawiki9pp..in
pantochromismdefpantochromi.smwhois.smSan Marinoianawiki13pp..sm
pantochronometerdefpantochronomet.erwhois.erEritreaianawiki16pp..er
pantodontidaedefpantodontid.aewhois.aeUnited Arab Emiratesianawiki13pp..ae
pantoflesdefpantofl.eswhois.esSpainianawiki9pp..es
pantoganglitisdefpantoganglit.iswhois.isIcelandianawiki14pp..is
pantoglossicaldefpantoglossic.alwhois.alAlbaniaianawiki14pp..al
pantoglottismdefpantoglotti.smwhois.smSan Marinoianawiki13pp..sm
pantographdefpantogra.phwhois.phPhilippinesianawiki10pp..ph
pantographerdefpantograph.erwhois.erEritreaianawiki12pp..er
pantographicaldefpantographic.alwhois.alAlbaniaianawiki14pp..al
pantographicallydefpantographical.lywhois.lyLibyan Arab Jamahiriyaianawiki16pp..ly
pantoiatricaldefpantoiatric.alwhois.alAlbaniaianawiki13pp..al
pantologicaldefpantologic.alwhois.alAlbaniaianawiki12pp..al
pantologistdefpantologi.stwhois.stSao Tome and Principeianawiki11pp..st
pantologydefpantolo.gywhois.gyGuyanaianawiki9pp..gy
pantomancerdefpantomanc.erwhois.erEritreaianawiki11pp..er
pantometerdefpantomet.erwhois.erEritreaianawiki10pp..er
pantometricaldefpantometric.alwhois.alAlbaniaianawiki13pp..al
pantomimesdefpantomim.eswhois.esSpainianawiki10pp..es
pantomimicaldefpantomimic.alwhois.alAlbaniaianawiki12pp..al
pantomimicallydefpantomimical.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
pantomimingdefpantomimi.ngwhois.ngNigeriaianawiki11pp..ng
pantomimishdefpantomimi.shwhois.shSaint Helenaianawiki11pp..sh
pantomimistdefpantomimi.stwhois.stSao Tome and Principeianawiki11pp..st
pantomimusdefpantomim.uswhois.usUnited Statesianawiki10pp..us
pantomorphdefpantomor.phwhois.phPhilippinesianawiki10pp..ph
pantonaldefpanton.alwhois.alAlbaniaianawiki8pp..al
pantopelagiandefpantopelagi.anwhois.anNetherlands Antillesianawiki13pp..an
pantophagistdefpantophagi.stwhois.stSao Tome and Principeianawiki12pp..st
pantophagousdefpantophago.uswhois.usUnited Statesianawiki12pp..us
pantophagydefpantopha.gywhois.gyGuyanaianawiki10pp..gy
pantophobousdefpantophobo.uswhois.usUnited Statesianawiki12pp..us
pantopterousdefpantoptero.uswhois.usUnited Statesianawiki12pp..us
pantoscopedefpantosco.pewhois.pePeruianawiki10pp..pe
pantostomatousdefpantostomato.uswhois.usUnited Statesianawiki14pp..us
pantothenicaciddefpantothenicac.idwhois.idIndonesiaianawiki15pp..id
pantotheredefpantothe.rewhois.reReunion Islandianawiki10pp..re
pantotheriandefpantotheri.anwhois.anNetherlands Antillesianawiki12pp..an
pantotypedefpantoty.pewhois.pePeruianawiki9pp..pe
pantoumdefpanto.umwhois.umUnited States Minor Outlying Islandsianawiki7pp..um
pantoumsdefpantou.mswhois.msMontserratianawiki8pp..ms
pantriesdefpantri.eswhois.esSpainianawiki8pp..es
pantropicaldefpantropic.alwhois.alAlbaniaianawiki11pp..al
pantropicallydefpantropical.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
pantrymandefpantrym.anwhois.anNetherlands Antillesianawiki9pp..an
pantrywomandefpantrywom.anwhois.anNetherlands Antillesianawiki11pp..an
pantssuitdefpantssu.itwhois.itItalyianawiki9pp..it
pantsuitdefpantsu.itwhois.itItalyianawiki8pp..it
panturaniandefpanturani.anwhois.anNetherlands Antillesianawiki11pp..an
panturanianismdefpanturaniani.smwhois.smSan Marinoianawiki14pp..sm
panturanismdefpanturani.smwhois.smSan Marinoianawiki11pp..sm
pantyhosedefpantyho.sewhois.seSwedenianawiki9pp..se
pantywaistdefpantywai.stwhois.stSao Tome and Principeianawiki10pp..st
panungdefpanu.ngwhois.ngNigeriaianawiki6pp..ng
panuredefpanu.rewhois.reReunion Islandianawiki6pp..re
panurgedefpanur.gewhois.geGeorgiaianawiki7pp..ge
panurgydefpanur.gywhois.gyGuyanaianawiki7pp..gy
panusdefpan.uswhois.usUnited Statesianawiki5pp..us
panyardefpany.arwhois.arArgentinaianawiki6pp..ar
panzadefpan.zawhois.zaSouth Africaianawiki5pp..za
panzerdefpanz.erwhois.erEritreaianawiki6pp..er
panzerfaustdefpanzerfau.stwhois.stSao Tome and Principeianawiki11pp..st
panzerwarfaredefpanzerwarfa.rewhois.reReunion Islandianawiki13pp..re
panzoismdefpanzoi.smwhois.smSan Marinoianawiki8pp..sm
paodefp.aowhois.aoAngolaianawiki3pp..ao
paoladefpao.lawhois.laLao People's Democratic Republicianawiki5pp..la
paolidefpao.liwhois.liLiechtensteinianawiki5pp..li
paolinadefpaoli.nawhois.naNamibiaianawiki7pp..na
paolobertoluccidefpaolobertoluc.ciwhois.ciCote d'Ivoireianawiki15pp..ci
paolobonifaciodefpaolobonifac.iowhois.ioBritish Indian Ocean Territoryianawiki14pp..io
paopaodefpaop.aowhois.aoAngolaianawiki6pp..ao
paoshandefpaosh.anwhois.anNetherlands Antillesianawiki7pp..an
paotingdefpaoti.ngwhois.ngNigeriaianawiki7pp..ng
papadefpa.pawhois.paPanamaianawiki4pp..pa
papaciesdefpapaci.eswhois.esSpainianawiki8pp..es
papacydefpapa.cywhois.cyCyprusianawiki6pp..cy
papagenadefpapage.nawhois.naNamibiaianawiki8pp..na
papagenodefpapage.nowhois.noNorwayianawiki8pp..no
papaindefpapa.inwhois.inIndiaianawiki6pp..in
papaiodefpapa.iowhois.ioBritish Indian Ocean Territoryianawiki6pp..io
papaldefpap.alwhois.alAlbaniaianawiki5pp..al
papalisedefpapali.sewhois.seSwedenianawiki8pp..se
papalismdefpapali.smwhois.smSan Marinoianawiki8pp..sm
papalistdefpapali.stwhois.stSao Tome and Principeianawiki8pp..st
papalizerdefpapaliz.erwhois.erEritreaianawiki9pp..er
papallydefpapal.lywhois.lyLibyan Arab Jamahiriyaianawiki7pp..ly
papalstatesdefpapalstat.eswhois.esSpainianawiki11pp..es
papanedefpapa.newhois.neNigerianawiki6pp..ne
papanicolaoutestdefpapanicolaoute.stwhois.stSao Tome and Principeianawiki16pp..st
papanicolaoutestdefpapanicolaou.testwhois.testPrivate TestingN/Awiki16pp..test
papaphobistdefpapaphobi.stwhois.stSao Tome and Principeianawiki11pp..st
papaprelaticaldefpapaprelatic.alwhois.alAlbaniaianawiki14pp..al
papaprelatistdefpapaprelati.stwhois.stSao Tome and Principeianawiki13pp..st
paparchicaldefpaparchic.alwhois.alAlbaniaianawiki11pp..al
paparockdefpaparo.ckwhois.ckCook Islandsianawiki8pp..ck
papasdefpap.aswhois.asAmerican Samoaianawiki5pp..as
papaverdefpapav.erwhois.erEritreaianawiki7pp..er
papaveraceaedefpapaverace.aewhois.aeUnited Arab Emiratesianawiki12pp..ae
papaveraceousdefpapaveraceo.uswhois.usUnited Statesianawiki13pp..us
papaveralesdefpapaveral.eswhois.esSpainianawiki11pp..es
papaverindefpapaver.inwhois.inIndiaianawiki9pp..in
papaverinedefpapaveri.newhois.neNigerianawiki10pp..ne
papaverousdefpapavero.uswhois.usUnited Statesianawiki10pp..us
papawdefpap.awwhois.awArubaianawiki5pp..aw
papawfamilydefpapawfami.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
papawsdefpapa.wswhois.wsWestern Samoaianawiki6pp..ws
papayaceaedefpapayace.aewhois.aeUnited Arab Emiratesianawiki10pp..ae
papayaceousdefpapayaceo.uswhois.usUnited Statesianawiki11pp..us
papayandefpapay.anwhois.anNetherlands Antillesianawiki7pp..an
papayasdefpapay.aswhois.asAmerican Samoaianawiki7pp..as
papayotindefpapayot.inwhois.inIndiaianawiki9pp..in
papboatdefpapbo.atwhois.atAustriaianawiki7pp..at
papedefpa.pewhois.pePeruianawiki4pp..pe
papelerasdefpapeler.aswhois.asAmerican Samoaianawiki9pp..as
papelonnedefpapelon.newhois.neNigerianawiki9pp..ne
paperdefpap.erwhois.erEritreaianawiki5pp..er
paperasseriedefpaperasser.iewhois.ieIrelandianawiki12pp..ie
paperbackdefpaperba.ckwhois.ckCook Islandsianawiki9pp..ck
paperbalerdefpaperbal.erwhois.erEritreaianawiki10pp..er
paperbalingdefpaperbali.ngwhois.ngNigeriaianawiki11pp..ng
paperbirchdefpaperbir.chwhois.chSwitzerlandianawiki10pp..ch
paperblockadedefpaperblocka.dewhois.deGermanyianawiki13pp..de
paperboundbooksinprintdefpaperboundbooksinpr.intwhois.intInternational Organizationsianawiki22pp..int
paperbushdefpaperbu.shwhois.shSaint Helenaianawiki9pp..sh
papercarrierdefpapercarri.erwhois.erEritreaianawiki12pp..er
paperchasedefpapercha.sewhois.seSwedenianawiki10pp..se
paperchaserdefpaperchas.erwhois.erEritreaianawiki11pp..er
paperchasingdefpaperchasi.ngwhois.ngNigeriaianawiki12pp..ng
paperclothdefpaperclo.thwhois.thThailandianawiki10pp..th
papercoaldefpaperco.alwhois.alAlbaniaianawiki9pp..al
papercoatingdefpapercoati.ngwhois.ngNigeriaianawiki12pp..ng
papercolorerdefpapercolor.erwhois.erEritreaianawiki12pp..er
papercreditdefpapercred.itwhois.itItalyianawiki11pp..it
papercutterdefpapercutt.erwhois.erEritreaianawiki11pp..er
papercuttingdefpapercutti.ngwhois.ngNigeriaianawiki12pp..ng
paperdollsdefpaperdol.lswhois.lsLesothoianawiki10pp..ls
paperdrillingdefpaperdrilli.ngwhois.ngNigeriaianawiki13pp..ng
paperembossingdefpaperembossi.ngwhois.ngNigeriaianawiki14pp..ng
papererdefpaper.erwhois.erEritreaianawiki7pp..er
paperflowerdefpaperflow.erwhois.erEritreaianawiki11pp..er
paperfoldingdefpaperfoldi.ngwhois.ngNigeriaianawiki12pp..ng
paperhangerdefpaperhang.erwhois.erEritreaianawiki11pp..er
paperhangingdefpaperhangi.ngwhois.ngNigeriaianawiki12pp..ng
paperhangingsdefpaperhangin.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki13pp..gs
paperholderdefpaperhold.erwhois.erEritreaianawiki11pp..er
paperhornetdefpaperhorn.etwhois.etEthiopiaianawiki11pp..et
paperhornetdefpaperhor.netwhois.netNetworksianawiki11pp..net
paperhousedefpaperhou.sewhois.seSwedenianawiki10pp..se
paperingdefpaperi.ngwhois.ngNigeriaianawiki8pp..ng
paperingsdefpaperin.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki9pp..gs
paperjoggerdefpaperjogg.erwhois.erEritreaianawiki11pp..er
paperjointdefpaperjo.intwhois.intInternational Organizationsianawiki10pp..int
paperknivesdefpaperkniv.eswhois.esSpainianawiki11pp..es
paperlapperdefpaperlapp.erwhois.erEritreaianawiki11pp..er
paperlikedefpaperli.kewhois.keKenyaianawiki9pp..ke
papermachinedefpapermachi.newhois.neNigerianawiki12pp..ne
papermakerdefpapermak.erwhois.erEritreaianawiki10pp..er
papermakingdefpapermaki.ngwhois.ngNigeriaianawiki11pp..ng
papermouthdefpapermou.thwhois.thThailandianawiki10pp..th
papermuslindefpapermusl.inwhois.inIndiaianawiki11pp..in
papernautilusdefpapernautil.uswhois.usUnited Statesianawiki13pp..us
papernautliusdefpapernautli.uswhois.usUnited Statesianawiki13pp..us
paperoverdefpaperov.erwhois.erEritreaianawiki9pp..er
paperprofitdefpaperprof.itwhois.itItalyianawiki11pp..it
paperpulperdefpaperpulp.erwhois.erEritreaianawiki11pp..er
paperrackdefpaperra.ckwhois.ckCook Islandsianawiki9pp..ck
papersavingdefpapersavi.ngwhois.ngNigeriaianawiki11pp..ng
papersculpturedefpapersculptu.rewhois.reReunion Islandianawiki14pp..re
papersellerdefpapersell.erwhois.erEritreaianawiki11pp..er
papersellingdefpaperselli.ngwhois.ngNigeriaianawiki12pp..ng
paperslittingdefpaperslitti.ngwhois.ngNigeriaianawiki13pp..ng
papersorterdefpapersort.erwhois.erEritreaianawiki11pp..er
papersparingdefpaperspari.ngwhois.ngNigeriaianawiki12pp..ng
paperstainerdefpaperstain.erwhois.erEritreaianawiki12pp..er
paperstampingdefpaperstampi.ngwhois.ngNigeriaianawiki13pp..ng
papersurplusdefpapersurpl.uswhois.usUnited Statesianawiki12pp..us
papertapedefpaperta.pewhois.pePeruianawiki9pp..pe
papertestingdefpapertesti.ngwhois.ngNigeriaianawiki12pp..ng
paperthickdefpaperthi.ckwhois.ckCook Islandsianawiki10pp..ck
paperthindefpaperth.inwhois.inIndiaianawiki9pp..in
papertigerdefpapertig.erwhois.erEritreaianawiki10pp..er
papertowelingdefpapertoweli.ngwhois.ngNigeriaianawiki13pp..ng
papertreedefpapertr.eewhois.eeEstoniaianawiki9pp..ee
paperusingdefpaperusi.ngwhois.ngNigeriaianawiki10pp..ng
papervarnisherdefpapervarnish.erwhois.erEritreaianawiki14pp..er
papervarnishingdefpapervarnishi.ngwhois.ngNigeriaianawiki15pp..ng
paperwardefpaperw.arwhois.arArgentinaianawiki8pp..ar
paperwaxingdefpaperwaxi.ngwhois.ngNigeriaianawiki11pp..ng
paperweightdefpaperweig.htwhois.htHaitiianawiki11pp..ht
papeteriedefpapeter.iewhois.ieIrelandianawiki9pp..ie
paphiandefpaphi.anwhois.anNetherlands Antillesianawiki7pp..an
paphiopedilumdefpaphiopedil.umwhois.umUnited States Minor Outlying Islandsianawiki13pp..um
paphusdefpaph.uswhois.usUnited Statesianawiki6pp..us
papiamentodefpapiamen.towhois.toTongaianawiki10pp..to
papiasdefpapi.aswhois.asAmerican Samoaianawiki6pp..as
papicolardefpapicol.arwhois.arArgentinaianawiki9pp..ar
papicolistdefpapicoli.stwhois.stSao Tome and Principeianawiki10pp..st
papierdefpapi.erwhois.erEritreaianawiki6pp..er
papiermchdefpapierm.chwhois.chSwitzerlandianawiki9pp..ch
papiliodefpapil.iowhois.ioBritish Indian Ocean Territoryianawiki7pp..io
papilionaceaedefpapilionace.aewhois.aeUnited Arab Emiratesianawiki13pp..ae
papilionaceousdefpapilionaceo.uswhois.usUnited Statesianawiki14pp..us
papilionesdefpapilion.eswhois.esSpainianawiki10pp..es
papilioniddefpapilion.idwhois.idIndonesiaianawiki10pp..id
papilionidaedefpapilionid.aewhois.aeUnited Arab Emiratesianawiki12pp..ae
papilionidesdefpapilionid.eswhois.esSpainianawiki12pp..es
papilioninaedefpapilionin.aewhois.aeUnited Arab Emiratesianawiki12pp..ae
papilioninedefpapilioni.newhois.neNigerianawiki11pp..ne
papilionoiddefpapiliono.idwhois.idIndonesiaianawiki11pp..id
papilladefpapil.lawhois.laLao People's Democratic Republicianawiki7pp..la
papillaedefpapill.aewhois.aeUnited Arab Emiratesianawiki8pp..ae
papillardefpapill.arwhois.arArgentinaianawiki8pp..ar
papillectomydefpapillecto.mywhois.myMalaysiaianawiki12pp..my
papilledemadefpapillede.mawhois.maMoroccoianawiki11pp..ma
papilliferousdefpapillifero.uswhois.usUnited Statesianawiki13pp..us
papillitisdefpapillit.iswhois.isIcelandianawiki10pp..is
papilloadenocystomadefpapilloadenocysto.mawhois.maMoroccoianawiki19pp..ma
papillocarcinomadefpapillocarcino.mawhois.maMoroccoianawiki16pp..ma
papilloedemadefpapilloede.mawhois.maMoroccoianawiki12pp..ma
papillomadefpapillo.mawhois.maMoroccoianawiki9pp..ma
papillomasdefpapillom.aswhois.asAmerican Samoaianawiki10pp..as
papillomatosisdefpapillomatos.iswhois.isIcelandianawiki14pp..is
papillomatousdefpapillomato.uswhois.usUnited Statesianawiki13pp..us
papilloretinitisdefpapilloretinit.iswhois.isIcelandianawiki16pp..is
papillosarcomadefpapillosarco.mawhois.maMoroccoianawiki14pp..ma
papillosedefpapillo.sewhois.seSwedenianawiki9pp..se
papillousdefpapillo.uswhois.usUnited Statesianawiki9pp..us
papinachoisdefpapinacho.iswhois.isIcelandianawiki11pp..is
papineaudefpapine.auwhois.auAustraliaianawiki8pp..au
papiniandefpapini.anwhois.anNetherlands Antillesianawiki8pp..an
papiodefpap.iowhois.ioBritish Indian Ocean Territoryianawiki5pp..io
papiopiodefpapiop.iowhois.ioBritish Indian Ocean Territoryianawiki8pp..io
papishdefpapi.shwhois.shSaint Helenaianawiki6pp..sh
papisherdefpapish.erwhois.erEritreaianawiki8pp..er
papismdefpapi.smwhois.smSan Marinoianawiki6pp..sm
papistdefpapi.stwhois.stSao Tome and Principeianawiki6pp..st
papisticaldefpapistic.alwhois.alAlbaniaianawiki10pp..al
papisticallydefpapistical.lywhois.lyLibyan Arab Jamahiriyaianawiki12pp..ly
papistlikedefpapistli.kewhois.keKenyaianawiki10pp..ke
papistlydefpapist.lywhois.lyLibyan Arab Jamahiriyaianawiki8pp..ly
papistriesdefpapistri.eswhois.esSpainianawiki10pp..es
papkedefpap.kewhois.keKenyaianawiki5pp..ke
paplikedefpapli.kewhois.keKenyaianawiki7pp..ke
papmeatdefpapme.atwhois.atAustriaianawiki7pp..at
papolaterdefpapolat.erwhois.erEritreaianawiki9pp..er
papolatrousdefpapolatro.uswhois.usUnited Statesianawiki11pp..us
papoosedefpapoo.sewhois.seSwedenianawiki7pp..se
papooserootdefpapoose.rootwhois.rootRoot Server InfrastructureN/Awiki11pp..root
papoosesdefpapoos.eswhois.esSpainianawiki8pp..es
papooshdefpapoo.shwhois.shSaint Helenaianawiki7pp..sh
papottodefpapot.towhois.toTongaianawiki7pp..to
papouladefpapou.lawhois.laLao People's Democratic Republicianawiki7pp..la
papovavirusdefpapovavir.uswhois.usUnited Statesianawiki11pp..us
pappaindefpappa.inwhois.inIndiaianawiki7pp..in
pappanodefpappa.nowhois.noNorwayianawiki7pp..no
pappasdefpapp.aswhois.asAmerican Samoaianawiki6pp..as
pappenheimerdefpappenheim.erwhois.erEritreaianawiki12pp..er
pappierdefpappi.erwhois.erEritreaianawiki7pp..er
pappiesdefpappi.eswhois.esSpainianawiki7pp..es
pappiestdefpappie.stwhois.stSao Tome and Principeianawiki8pp..st
pappiferousdefpappifero.uswhois.usUnited Statesianawiki11pp..us
pappoosedefpappoo.sewhois.seSwedenianawiki8pp..se
pappoosesdefpappoos.eswhois.esSpainianawiki9pp..es
papposedefpappo.sewhois.seSwedenianawiki7pp..se
pappousdefpappo.uswhois.usUnited Statesianawiki7pp..us
pappusdefpapp.uswhois.usUnited Statesianawiki6pp..us
pappydefpap.pywhois.pyParaguayianawiki5pp..py
papregdefpapr.egwhois.egEgyptianawiki6pp..eg
papricadefpapri.cawhois.caCanadaianawiki7pp..ca
papricasdefpapric.aswhois.asAmerican Samoaianawiki8pp..as
paprikasdefpaprik.aswhois.asAmerican Samoaianawiki8pp..as
papsdefpa.pswhois.psPalestinian Territory (Occupied)ianawiki4pp..ps
papstdefpap.stwhois.stSao Tome and Principeianawiki5pp..st
papsukaidefpapsuk.aiwhois.aiAnguillaianawiki8pp..ai
paptestdefpapte.stwhois.stSao Tome and Principeianawiki7pp..st
paptestdefpap.testwhois.testPrivate TestingN/Awiki7pp..test
papuadefpap.uawhois.uaUkraineianawiki5pp..ua
papuandefpapu.anwhois.anNetherlands Antillesianawiki6pp..an
papuanutmegdefpapuanutm.egwhois.egEgyptianawiki11pp..eg
papuladefpapu.lawhois.laLao People's Democratic Republicianawiki6pp..la
papulaedefpapul.aewhois.aeUnited Arab Emiratesianawiki7pp..ae
papulandefpapul.anwhois.anNetherlands Antillesianawiki7pp..an
papulardefpapul.arwhois.arArgentinaianawiki7pp..ar
papularrashdefpapularra.shwhois.shSaint Helenaianawiki11pp..sh
papulesdefpapul.eswhois.esSpainianawiki7pp..es
papuliferousdefpapulifero.uswhois.usUnited Statesianawiki12pp..us
papuloerythematousdefpapuloerythemato.uswhois.usUnited Statesianawiki18pp..us
papulopustulardefpapulopustul.arwhois.arArgentinaianawiki14pp..ar
papulosedefpapulo.sewhois.seSwedenianawiki8pp..se
papulosquamousdefpapulosquamo.uswhois.usUnited Statesianawiki14pp..us
papulousdefpapulo.uswhois.usUnited Statesianawiki8pp..us
papulovesiculardefpapulovesicul.arwhois.arArgentinaianawiki15pp..ar
papyraceousdefpapyraceo.uswhois.usUnited Statesianawiki11pp..us
papyraldefpapyr.alwhois.alAlbaniaianawiki7pp..al
papyreandefpapyre.anwhois.anNetherlands Antillesianawiki8pp..an
papyriandefpapyri.anwhois.anNetherlands Antillesianawiki8pp..an
papyrindefpapyr.inwhois.inIndiaianawiki7pp..in
papyrinedefpapyri.newhois.neNigerianawiki8pp..ne
papyritiousdefpapyritio.uswhois.usUnited Statesianawiki11pp..us
papyrodefpapy.rowhois.roRomaniaianawiki6pp..ro
papyrocracydefpapyrocra.cywhois.cyCyprusianawiki11pp..cy
papyrographdefpapyrogra.phwhois.phPhilippinesianawiki11pp..ph
papyrographerdefpapyrograph.erwhois.erEritreaianawiki13pp..er
papyrologicaldefpapyrologic.alwhois.alAlbaniaianawiki13pp..al
papyrologistdefpapyrologi.stwhois.stSao Tome and Principeianawiki12pp..st
papyrologydefpapyrolo.gywhois.gyGuyanaianawiki10pp..gy
papyroplasticsdefpapyroplasti.cswhois.csSerbia and Montenegroianawiki14pp..cs
papyrotintdefpapyrot.intwhois.intInternational Organizationsianawiki10pp..int
papyrotypedefpapyroty.pewhois.pePeruianawiki10pp..pe
papyrusdefpapyr.uswhois.usUnited Statesianawiki7pp..us
papyruscapitaldefpapyruscapit.alwhois.alAlbaniaianawiki14pp..al
papyruscolumndefpapyruscolu.mnwhois.mnMongoliaianawiki13pp..mn
papyrusesdefpapyrus.eswhois.esSpainianawiki9pp..es
paquetdefpaqu.etwhois.etEthiopiaianawiki6pp..et
paquitodefpaqui.towhois.toTongaianawiki7pp..to
pardefp.arwhois.arArgentinaianawiki3pp..ar
paraagglutinindefparaagglutin.inwhois.inIndiaianawiki14pp..in
paraaminobenzoicaciddefparaaminobenzoicac.idwhois.idIndonesiaianawiki20pp..id
paraappendicitisdefparaappendicit.iswhois.isIcelandianawiki16pp..is
parabaptismdefparabapti.smwhois.smSan Marinoianawiki11pp..sm
parabasaldefparabas.alwhois.alAlbaniaianawiki9pp..al
parabasesdefparabas.eswhois.esSpainianawiki9pp..es
parabasisdefparabas.iswhois.isIcelandianawiki9pp..is
parabemadefparabe.mawhois.maMoroccoianawiki8pp..ma
parabenzoquinonedefparabenzoquino.newhois.neNigerianawiki16pp..ne
parabiosisdefparabios.iswhois.isIcelandianawiki10pp..is
parabioticallydefparabiotical.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
parablastdefparabla.stwhois.stSao Tome and Principeianawiki9pp..st
parablepsisdefparableps.iswhois.isIcelandianawiki11pp..is
parablepsydefparablep.sywhois.sySyrian Arab Republicianawiki10pp..sy
parablesdefparabl.eswhois.esSpainianawiki8pp..es
parablingdefparabli.ngwhois.ngNigeriaianawiki9pp..ng
paraboladefparabo.lawhois.laLao People's Democratic Republicianawiki8pp..la
parabolanusdefparabolan.uswhois.usUnited Statesianawiki11pp..us
parabolasdefparabol.aswhois.asAmerican Samoaianawiki9pp..as
parabolicaerialdefparabolicaeri.alwhois.alAlbaniaianawiki15pp..al
parabolicaldefparabolic.alwhois.alAlbaniaianawiki11pp..al
parabolicalismdefparabolicali.smwhois.smSan Marinoianawiki14pp..sm
parabolicallydefparabolical.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
parabolicantennadefparabolicanten.nawhois.naNamibiaianawiki16pp..na
parabolicreflectormicrophonedefparabolicreflectormicropho.newhois.neNigerianawiki28pp..ne
parabolisedefparaboli.sewhois.seSwedenianawiki10pp..se
parabolisingdefparabolisi.ngwhois.ngNigeriaianawiki12pp..ng
parabolistdefparaboli.stwhois.stSao Tome and Principeianawiki10pp..st
parabolizerdefparaboliz.erwhois.erEritreaianawiki11pp..er
parabolizingdefparabolizi.ngwhois.ngNigeriaianawiki12pp..ng
paraboloiddefparabolo.idwhois.idIndonesiaianawiki10pp..id
paraboloidaldefparaboloid.alwhois.alAlbaniaianawiki12pp..al
parabotulismdefparabotuli.smwhois.smSan Marinoianawiki12pp..sm
parabrakedefparabra.kewhois.keKenyaianawiki9pp..ke
parabranchialdefparabranchi.alwhois.alAlbaniaianawiki13pp..al
paracanthosisdefparacanthos.iswhois.isIcelandianawiki13pp..is
paracarminedefparacarmi.newhois.neNigerianawiki11pp..ne
paracaseindefparacase.inwhois.inIndiaianawiki10pp..in
paracelsiandefparacelsi.anwhois.anNetherlands Antillesianawiki11pp..an
paracelsianismdefparacelsiani.smwhois.smSan Marinoianawiki14pp..sm
paracelsistdefparacelsi.stwhois.stSao Tome and Principeianawiki11pp..st
paracelsusdefparacels.uswhois.usUnited Statesianawiki10pp..us
paracentesesdefparacentes.eswhois.esSpainianawiki12pp..es
paracentesisdefparacentes.iswhois.isIcelandianawiki12pp..is
paracentraldefparacentr.alwhois.alAlbaniaianawiki11pp..al
paracentricaldefparacentric.alwhois.alAlbaniaianawiki13pp..al
paracephalusdefparacephal.uswhois.usUnited Statesianawiki12pp..us
paracerebellardefparacerebell.arwhois.arArgentinaianawiki14pp..ar
paracetaldehydedefparacetaldehy.dewhois.deGermanyianawiki15pp..de
parachaplaindefparachapla.inwhois.inIndiaianawiki12pp..in
parachordaldefparachord.alwhois.alAlbaniaianawiki11pp..al
parachromadefparachro.mawhois.maMoroccoianawiki10pp..ma
parachromatismdefparachromati.smwhois.smSan Marinoianawiki14pp..sm
parachromatophorousdefparachromatophoro.uswhois.usUnited Statesianawiki19pp..us
parachromatosisdefparachromatos.iswhois.isIcelandianawiki15pp..is
parachromoparousdefparachromoparo.uswhois.usUnited Statesianawiki16pp..us
parachromophorousdefparachromophoro.uswhois.usUnited Statesianawiki17pp..us
parachronismdefparachroni.smwhois.smSan Marinoianawiki12pp..sm
parachrosedefparachro.sewhois.seSwedenianawiki10pp..se
parachuteapproachdefparachuteapproa.chwhois.chSwitzerlandianawiki17pp..ch
parachutebadgedefparachutebad.gewhois.geGeorgiaianawiki14pp..ge
parachutebrakedefparachutebra.kewhois.keKenyaianawiki14pp..ke
parachuteflaredefparachutefla.rewhois.reReunion Islandianawiki14pp..re
parachutejumpdefparachuteju.mpwhois.mpNorthern Mariana Islandsianawiki13pp..mp
parachutejumperdefparachutejump.erwhois.erEritreaianawiki15pp..er
parachutelightdefparachutelig.htwhois.htHaitiianawiki14pp..ht
parachuterdefparachut.erwhois.erEritreaianawiki10pp..er
parachuteriggerdefparachuterigg.erwhois.erEritreaianawiki15pp..er
parachutesdefparachut.eswhois.esSpainianawiki10pp..es
parachutespinnakerdefparachutespinnak.erwhois.erEritreaianawiki18pp..er
parachutetroopsdefparachutetroo.pswhois.psPalestinian Territory (Occupied)ianawiki15pp..ps
parachutingdefparachuti.ngwhois.ngNigeriaianawiki11pp..ng
parachutismdefparachuti.smwhois.smSan Marinoianawiki11pp..sm
parachutistdefparachuti.stwhois.stSao Tome and Principeianawiki11pp..st
paraciumdefparaci.umwhois.umUnited States Minor Outlying Islandsianawiki8pp..um
paracmasisdefparacmas.iswhois.isIcelandianawiki10pp..is
paracoeliandefparacoeli.anwhois.anNetherlands Antillesianawiki11pp..an
paracolitisdefparacolit.iswhois.isIcelandianawiki11pp..is
paracolpitisdefparacolpit.iswhois.isIcelandianawiki12pp..is
paracolpiumdefparacolpi.umwhois.umUnited States Minor Outlying Islandsianawiki11pp..um
paracondyloiddefparacondylo.idwhois.idIndonesiaianawiki13pp..id
paraconedefparaco.newhois.neNigerianawiki8pp..ne
paraconiddefparacon.idwhois.idIndonesiaianawiki9pp..id
paraconsciousdefparaconscio.uswhois.usUnited Statesianawiki13pp..us
paracorolladefparacorol.lawhois.laLao People's Democratic Republicianawiki11pp..la
paracotoindefparacoto.inwhois.inIndiaianawiki10pp..in
paracusisdefparacus.iswhois.isIcelandianawiki9pp..is
paracyesesdefparacyes.eswhois.esSpainianawiki10pp..es
paracyesisdefparacyes.iswhois.isIcelandianawiki10pp..is
paracymenedefparacyme.newhois.neNigerianawiki10pp..ne
paracystitisdefparacystit.iswhois.isIcelandianawiki12pp..is
paracystiumdefparacysti.umwhois.umUnited States Minor Outlying Islandsianawiki11pp..um
paradedefpara.dewhois.deGermanyianawiki6pp..de
paradelikedefparadeli.kewhois.keKenyaianawiki10pp..ke
paradenitisdefparadenit.iswhois.isIcelandianawiki11pp..is
paradentaldefparadent.alwhois.alAlbaniaianawiki10pp..al
paradentitisdefparadentit.iswhois.isIcelandianawiki12pp..is
paradentiumdefparadenti.umwhois.umUnited States Minor Outlying Islandsianawiki11pp..um
paraderdefparad.erwhois.erEritreaianawiki7pp..er
paraderestdefparadere.stwhois.stSao Tome and Principeianawiki10pp..st
paradesdefparad.eswhois.esSpainianawiki7pp..es
paradeyourwaresdefparadeyourwar.eswhois.esSpainianawiki15pp..es
paradiazinedefparadiazi.newhois.neNigerianawiki11pp..ne
paradichlorbenzenedefparadichlorbenze.newhois.neNigerianawiki18pp..ne
paradichlorobenzenedefparadichlorobenze.newhois.neNigerianawiki19pp..ne
paradidymaldefparadidym.alwhois.alAlbaniaianawiki11pp..al
paradidymisdefparadidym.iswhois.isIcelandianawiki11pp..is
paradiesdefparadi.eswhois.esSpainianawiki8pp..es
paradigmdefparadi.gmwhois.gmGambiaianawiki8pp..gm
paradigmaticaldefparadigmatic.alwhois.alAlbaniaianawiki14pp..al
paradigmaticallydefparadigmatical.lywhois.lyLibyan Arab Jamahiriyaianawiki16pp..ly
paradigmcasedefparadigmca.sewhois.seSwedenianawiki12pp..se
paradigmsdefparadig.mswhois.msMontserratianawiki9pp..ms
paradingdefparadi.ngwhois.ngNigeriaianawiki8pp..ng
paradinglydefparading.lywhois.lyLibyan Arab Jamahiriyaianawiki10pp..ly
paradisdefparad.iswhois.isIcelandianawiki7pp..is
paradisaicaldefparadisaic.alwhois.alAlbaniaianawiki12pp..al
paradisaicallydefparadisaical.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
paradisaldefparadis.alwhois.alAlbaniaianawiki9pp..al
paradisallydefparadisal.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
paradisedefparadi.sewhois.seSwedenianawiki8pp..se
paradiseandefparadise.anwhois.anNetherlands Antillesianawiki10pp..an
paradiseduckdefparadisedu.ckwhois.ckCook Islandsianawiki12pp..ck
paradisefinchdefparadisefin.chwhois.chSwitzerlandianawiki13pp..ch
paradisefishdefparadisefi.shwhois.shSaint Helenaianawiki12pp..sh
paradiseflowerdefparadiseflow.erwhois.erEritreaianawiki14pp..er
paradiseflycatcherdefparadiseflycatch.erwhois.erEritreaianawiki18pp..er
paradiseidaedefparadiseid.aewhois.aeUnited Arab Emiratesianawiki12pp..ae
paradiseinaedefparadisein.aewhois.aeUnited Arab Emiratesianawiki12pp..ae
paradisesdefparadis.eswhois.esSpainianawiki9pp..es
paradisestockdefparadisesto.ckwhois.ckCook Islandsianawiki13pp..ck
paradisetreedefparadisetr.eewhois.eeEstoniaianawiki12pp..ee
paradisiacdefparadisi.acwhois.acAscension Islandianawiki10pp..ac
paradisiacaldefparadisiac.alwhois.alAlbaniaianawiki12pp..al
paradisiacallydefparadisiacal.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
paradisialdefparadisi.alwhois.alAlbaniaianawiki10pp..al
paradisiandefparadisi.anwhois.anNetherlands Antillesianawiki10pp..an
paradisicaldefparadisic.alwhois.alAlbaniaianawiki11pp..al
paradisodefparadi.sowhois.soSomaliaianawiki8pp..so
paradodefpara.dowhois.doDominican Republicianawiki6pp..do
paradosesdefparados.eswhois.esSpainianawiki9pp..es
paradoxaldefparadox.alwhois.alAlbaniaianawiki9pp..al
paradoxerdefparadox.erwhois.erEritreaianawiki9pp..er
paradoxesdefparadox.eswhois.esSpainianawiki9pp..es
paradoxialdefparadoxi.alwhois.alAlbaniaianawiki10pp..al
paradoxicaldefparadoxic.alwhois.alAlbaniaianawiki11pp..al
paradoxicalismdefparadoxicali.smwhois.smSan Marinoianawiki14pp..sm
paradoxicallydefparadoxical.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
paradoxiciandefparadoxici.anwhois.anNetherlands Antillesianawiki12pp..an
paradoxidesdefparadoxid.eswhois.esSpainianawiki11pp..es
paradoxidiandefparadoxidi.anwhois.anNetherlands Antillesianawiki12pp..an
paradoxismdefparadoxi.smwhois.smSan Marinoianawiki10pp..sm
paradoxistdefparadoxi.stwhois.stSao Tome and Principeianawiki10pp..st
paradoxographerdefparadoxograph.erwhois.erEritreaianawiki15pp..er
paradoxographicaldefparadoxographic.alwhois.alAlbaniaianawiki17pp..al
paradoxologydefparadoxolo.gywhois.gyGuyanaianawiki12pp..gy
paradoxuredefparadoxu.rewhois.reReunion Islandianawiki10pp..re
paradoxurinaedefparadoxurin.aewhois.aeUnited Arab Emiratesianawiki13pp..ae
paradoxurinedefparadoxuri.newhois.neNigerianawiki12pp..ne
paradoxurusdefparadoxur.uswhois.usUnited Statesianawiki11pp..us
paradroppingdefparadroppi.ngwhois.ngNigeriaianawiki12pp..ng
paradropsdefparadro.pswhois.psPalestinian Territory (Occupied)ianawiki9pp..ps
paraebiusdefparaebi.uswhois.usUnited Statesianawiki9pp..us
paraenesisdefparaenes.iswhois.isIcelandianawiki10pp..is
paraeneticaldefparaenetic.alwhois.alAlbaniaianawiki12pp..al
paraengineerdefparaengine.erwhois.erEritreaianawiki12pp..er
paraffindefparaff.inwhois.inIndiaianawiki8pp..in
paraffinbasedefparaffinba.sewhois.seSwedenianawiki12pp..se
paraffinbaseoildefparaffinbaseo.ilwhois.ilIsraelianawiki15pp..il
paraffinedefparaffi.newhois.neNigerianawiki9pp..ne
paraffinerdefparaffin.erwhois.erEritreaianawiki10pp..er
paraffiningdefparaffini.ngwhois.ngNigeriaianawiki11pp..ng
paraffinizingdefparaffinizi.ngwhois.ngNigeriaianawiki13pp..ng
paraffinoiddefparaffino.idwhois.idIndonesiaianawiki11pp..id
paraffinoildefparaffino.ilwhois.ilIsraelianawiki11pp..il
paraffinpaperdefparaffinpap.erwhois.erEritreaianawiki13pp..er
paraffinseriesdefparaffinseri.eswhois.esSpainianawiki14pp..es
paraffinwaxdefparaffinw.axwhois.axAland Islandsianawiki11pp..ax
paraflocculardefparafloccul.arwhois.arArgentinaianawiki13pp..ar
paraflocculusdefparafloccul.us