Xona.comDomain HacksSuggest


Over 300,000 domain hack suggestions.
[an error occurred while processing this directive]

There are 6,069 domain hacks for words that start with pr.
First Letter: number A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Second Letter: number A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Word Domain Name Top-Level Domain Filter
Word Definition Domain Whois TLD Description IANA Wikipedia Length TLD
praamdefpra.amwhois.amArmeniaianawiki5pp..am
praamsdefpraa.mswhois.msMontserratianawiki6pp..ms
prabhudefprab.huwhois.huHungaryianawiki6pp..hu
practicabilitiesdefpracticabiliti.eswhois.esSpainianawiki16pp..es
practicablydefpracticab.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
practicaldefpractic.alwhois.alAlbaniaianawiki9pp..al
practicalismdefpracticali.smwhois.smSan Marinoianawiki12pp..sm
practicalistdefpracticali.stwhois.stSao Tome and Principeianawiki12pp..st
practicalitiesdefpracticaliti.eswhois.esSpainianawiki14pp..es
practicalizerdefpracticaliz.erwhois.erEritreaianawiki13pp..er
practicaljokedefpracticaljo.kewhois.keKenyaianawiki13pp..ke
practicaljokerdefpracticaljok.erwhois.erEritreaianawiki14pp..er
practicalknowledgedefpracticalknowled.gewhois.geGeorgiaianawiki18pp..ge
practicallydefpractical.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
practicalmechanicsdefpracticalmechani.cswhois.csSerbia and Montenegroianawiki18pp..cs
practicalnursedefpracticalnur.sewhois.seSwedenianawiki14pp..se
practicalpoliticsdefpracticalpoliti.cswhois.csSerbia and Montenegroianawiki17pp..cs
practicalscientistdefpracticalscienti.stwhois.stSao Tome and Principeianawiki18pp..st
practicaltestdefpracticalte.stwhois.stSao Tome and Principeianawiki13pp..st
practicaltestdefpractical.testwhois.testPrivate TestingN/Awiki13pp..test
practicaltheologydefpracticaltheolo.gywhois.gyGuyanaianawiki17pp..gy
practicalwisdomdefpracticalwisd.omwhois.omOmanianawiki15pp..om
practiceatthebardefpracticeattheb.arwhois.arArgentinaianawiki16pp..ar
practicecurvedefpracticecur.vewhois.veVenezuelaianawiki13pp..ve
practicelandingdefpracticelandi.ngwhois.ngNigeriaianawiki15pp..ng
practicelawdefpracticel.awwhois.awArubaianawiki11pp..aw
practicemedicinedefpracticemedici.newhois.neNigerianawiki16pp..ne
practiceofmedicinedefpracticeofmedici.newhois.neNigerianawiki18pp..ne
practicerdefpractic.erwhois.erEritreaianawiki9pp..er
practicesdefpractic.eswhois.esSpainianawiki9pp..es
practiceselfdenialdefpracticeselfdeni.alwhois.alAlbaniaianawiki18pp..al
practicespiritualismdefpracticespirituali.smwhois.smSan Marinoianawiki20pp..sm
practiceteachdefpracticetea.chwhois.chSwitzerlandianawiki13pp..ch
practiceteacherdefpracticeteach.erwhois.erEritreaianawiki15pp..er
practiceteachingdefpracticeteachi.ngwhois.ngNigeriaianawiki16pp..ng
practiciandefpractici.anwhois.anNetherlands Antillesianawiki10pp..an
practicianismdefpracticiani.smwhois.smSan Marinoianawiki13pp..sm
practicingdefpractici.ngwhois.ngNigeriaianawiki10pp..ng
practicodefpracti.cowhois.coColombiaianawiki8pp..co
practicumdefpractic.umwhois.umUnited States Minor Outlying Islandsianawiki9pp..um
practisedefpracti.sewhois.seSwedenianawiki8pp..se
practiserdefpractis.erwhois.erEritreaianawiki9pp..er
practisesdefpractis.eswhois.esSpainianawiki9pp..es
practisingdefpractisi.ngwhois.ngNigeriaianawiki10pp..ng
practitionaldefpractition.alwhois.alAlbaniaianawiki12pp..al
practitionerdefpractition.erwhois.erEritreaianawiki12pp..er
practivedefpracti.vewhois.veVenezuelaianawiki8pp..ve
praddefpr.adwhois.adAndorraianawiki4pp..ad
praderdefprad.erwhois.erEritreaianawiki6pp..er
pradeshdefprade.shwhois.shSaint Helenaianawiki7pp..sh
pradhanadefpradha.nawhois.naNamibiaianawiki8pp..na
pradodefpra.dowhois.doDominican Republicianawiki5pp..do
praedefpr.aewhois.aeUnited Arab Emiratesianawiki4pp..ae
praeacetabulardefpraeacetabul.arwhois.arArgentinaianawiki14pp..ar
praeanaldefpraean.alwhois.alAlbaniaianawiki8pp..al
praecavadefpraeca.vawhois.vaHoly See (Vatican City State)ianawiki8pp..va
praecipedefpraeci.pewhois.pePeruianawiki8pp..pe
praecipesdefpraecip.eswhois.esSpainianawiki9pp..es
praecipitatiodefpraecipitat.iowhois.ioBritish Indian Ocean Territoryianawiki13pp..io
praecipuumdefpraecipu.umwhois.umUnited States Minor Outlying Islandsianawiki10pp..um
praecocesdefpraecoc.eswhois.esSpainianawiki9pp..es
praecocialdefpraecoci.alwhois.alAlbaniaianawiki10pp..al
praecognitumdefpraecognit.umwhois.umUnited States Minor Outlying Islandsianawiki12pp..um
praecoracoiddefpraecoraco.idwhois.idIndonesiaianawiki12pp..id
praecordialdefpraecordi.alwhois.alAlbaniaianawiki11pp..al
praecordiumdefpraecordi.umwhois.umUnited States Minor Outlying Islandsianawiki11pp..um
praecornudefpraecor.nuwhois.nuNiueianawiki9pp..nu
praecuneusdefpraecune.uswhois.usUnited Statesianawiki10pp..us
praedialdefpraedi.alwhois.alAlbaniaianawiki8pp..al
praedialistdefpraediali.stwhois.stSao Tome and Principeianawiki11pp..st
praediumdefpraedi.umwhois.umUnited States Minor Outlying Islandsianawiki8pp..um
praeesophagealdefpraeesophage.alwhois.alAlbaniaianawiki14pp..al
praefectorialdefpraefectori.alwhois.alAlbaniaianawiki13pp..al
praefectusdefpraefect.uswhois.usUnited Statesianawiki10pp..us
praeferviddefpraeferv.idwhois.idIndonesiaianawiki10pp..id
praelabrumdefpraelabr.umwhois.umUnited States Minor Outlying Islandsianawiki10pp..um
praelectingdefpraelecti.ngwhois.ngNigeriaianawiki11pp..ng
praelectionisdefpraelection.iswhois.isIcelandianawiki13pp..is
praeludiumdefpraeludi.umwhois.umUnited States Minor Outlying Islandsianawiki10pp..um
praemaxilladefpraemaxil.lawhois.laLao People's Democratic Republicianawiki11pp..la
praemolardefpraemol.arwhois.arArgentinaianawiki9pp..ar
praemunientesdefpraemunient.eswhois.esSpainianawiki13pp..es
praemunientesclausedefpraemunientesclau.sewhois.seSwedenianawiki19pp..se
praemunienteswritdefpraemunienteswr.itwhois.itItalyianawiki17pp..it
praemuniredefpraemuni.rewhois.reReunion Islandianawiki10pp..re
praenarialdefpraenari.alwhois.alAlbaniaianawiki10pp..al
praenestinedefpraenesti.newhois.neNigerianawiki11pp..ne
praenestiniandefpraenestini.anwhois.anNetherlands Antillesianawiki13pp..an
praeneuraldefpraeneur.alwhois.alAlbaniaianawiki10pp..al
praenominadefpraenomi.nawhois.naNamibiaianawiki10pp..na
praenominaldefpraenomin.alwhois.alAlbaniaianawiki11pp..al
praeoperculumdefpraeopercul.umwhois.umUnited States Minor Outlying Islandsianawiki13pp..um
praeposituredefpraepositu.rewhois.reReunion Islandianawiki12pp..re
praepositusdefpraeposit.uswhois.usUnited Statesianawiki11pp..us
praeposterdefpraepost.erwhois.erEritreaianawiki10pp..er
praepostorialdefpraepostori.alwhois.alAlbaniaianawiki13pp..al
praepubisdefpraepub.iswhois.isIcelandianawiki9pp..is
praescutumdefpraescut.umwhois.umUnited States Minor Outlying Islandsianawiki10pp..um
praesepedefpraese.pewhois.pePeruianawiki8pp..pe
praesertimdefpraesert.imwhois.imIsle of Manianawiki10pp..im
praesesdefpraes.eswhois.esSpainianawiki7pp..es
praesiandefpraesi.anwhois.anNetherlands Antillesianawiki8pp..an
praesidiumdefpraesidi.umwhois.umUnited States Minor Outlying Islandsianawiki10pp..um
praesphenoiddefpraespheno.idwhois.idIndonesiaianawiki12pp..id
praesternaldefpraestern.alwhois.alAlbaniaianawiki11pp..al
praesternumdefpraestern.umwhois.umUnited States Minor Outlying Islandsianawiki11pp..um
praestomiumdefpraestomi.umwhois.umUnited States Minor Outlying Islandsianawiki11pp..um
praetextaedefpraetext.aewhois.aeUnited Arab Emiratesianawiki10pp..ae
praetorialdefpraetori.alwhois.alAlbaniaianawiki10pp..al
praetoriandefpraetori.anwhois.anNetherlands Antillesianawiki10pp..an
praetorianismdefpraetoriani.smwhois.smSan Marinoianawiki13pp..sm
praetoriumdefpraetori.umwhois.umUnited States Minor Outlying Islandsianawiki10pp..um
praetoriusdefpraetori.uswhois.usUnited Statesianawiki10pp..us
praezygapophysisdefpraezygapophys.iswhois.isIcelandianawiki16pp..is
pragdefpr.agwhois.agAntigua and Barbudaianawiki4pp..ag
pragerdefprag.erwhois.erEritreaianawiki6pp..er
pragmatdefpragm.atwhois.atAustriaianawiki7pp..at
pragmaticadefpragmati.cawhois.caCanadaianawiki10pp..ca
pragmaticaldefpragmatic.alwhois.alAlbaniaianawiki11pp..al
pragmaticallydefpragmatical.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
pragmaticismdefpragmatici.smwhois.smSan Marinoianawiki12pp..sm
pragmaticistdefpragmatici.stwhois.stSao Tome and Principeianawiki12pp..st
pragmaticsdefpragmati.cswhois.csSerbia and Montenegroianawiki10pp..cs
pragmatictheoryoftruthdefpragmatictheoryoftru.thwhois.thThailandianawiki22pp..th
pragmatismdefpragmati.smwhois.smSan Marinoianawiki10pp..sm
pragmatismsdefpragmatis.mswhois.msMontserratianawiki11pp..ms
pragmatistdefpragmati.stwhois.stSao Tome and Principeianawiki10pp..st
pragmatizerdefpragmatiz.erwhois.erEritreaianawiki11pp..er
prahamdefprah.amwhois.amArmeniaianawiki6pp..am
prahmdefpra.hmwhois.hmHeard and McDonald Islandsianawiki5pp..hm
prahudefpra.huwhois.huHungaryianawiki5pp..hu
prahusdefprah.uswhois.usUnited Statesianawiki6pp..us
prairialdefprairi.alwhois.alAlbaniaianawiki8pp..al
prairiedefprair.iewhois.ieIrelandianawiki7pp..ie
prairieartichokedefprairiearticho.kewhois.keKenyaianawiki16pp..ke
prairieasterdefprairieast.erwhois.erEritreaianawiki12pp..er
prairiebreakerdefprairiebreak.erwhois.erEritreaianawiki14pp..er
prairiebuttonsnakerootdefprairiebuttonsnake.rootwhois.rootRoot Server InfrastructureN/Awiki22pp..root
prairiecloverdefprairieclov.erwhois.erEritreaianawiki13pp..er
prairieconeflowerdefprairieconeflow.erwhois.erEritreaianawiki17pp..er
prairiedockdefprairiedo.ckwhois.ckCook Islandsianawiki11pp..ck
prairiedomdefprairied.omwhois.omOmanianawiki10pp..om
prairiefiredefprairiefi.rewhois.reReunion Islandianawiki11pp..re
prairiegoosedefprairiegoo.sewhois.seSwedenianawiki12pp..se
prairiegrousedefprairiegrou.sewhois.seSwedenianawiki13pp..se
prairieitchdefprairieit.chwhois.chSwitzerlandianawiki11pp..ch
prairielikedefprairieli.kewhois.keKenyaianawiki11pp..ke
prairielilydefprairieli.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
prairieoysterdefprairieoyst.erwhois.erEritreaianawiki13pp..er
prairiepinedefprairiepi.newhois.neNigerianawiki11pp..ne
prairiepointerdefprairiepoint.erwhois.erEritreaianawiki14pp..er
prairiepoppydefprairiepop.pywhois.pyParaguayianawiki12pp..py
prairieprovincesdefprairieprovinc.eswhois.esSpainianawiki16pp..es
prairierattlesnakedefprairierattlesna.kewhois.keKenyaianawiki18pp..ke
prairierocketdefprairierock.etwhois.etEthiopiaianawiki13pp..et
prairierosedefprairiero.sewhois.seSwedenianawiki11pp..se
prairiesdefprairi.eswhois.esSpainianawiki8pp..es
prairiesagedefprairiesa.gewhois.geGeorgiaianawiki11pp..ge
prairieschoonerdefprairieschoon.erwhois.erEritreaianawiki15pp..er
prairiesmokedefprairiesmo.kewhois.keKenyaianawiki12pp..ke
prairiesoildefprairieso.ilwhois.ilIsraelianawiki11pp..il
prairievioletdefprairieviol.etwhois.etEthiopiaianawiki13pp..et
prairiewakerobindefprairiewakerob.inwhois.inIndiaianawiki16pp..in
prairiewarblerdefprairiewarbl.erwhois.erEritreaianawiki14pp..er
praisablydefpraisab.lywhois.lyLibyan Arab Jamahiriyaianawiki9pp..ly
praisedefprai.sewhois.seSwedenianawiki6pp..se
praisebeggingdefpraisebeggi.ngwhois.ngNigeriaianawiki13pp..ng
praisedeservingdefpraisedeservi.ngwhois.ngNigeriaianawiki15pp..ng
praisefatherdefpraisefath.erwhois.erEritreaianawiki12pp..er
praisefullydefpraiseful.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
praisegivingdefpraisegivi.ngwhois.ngNigeriaianawiki12pp..ng
praisemeetingdefpraisemeeti.ngwhois.ngNigeriaianawiki13pp..ng
praiserdefprais.erwhois.erEritreaianawiki7pp..er
praisesdefprais.eswhois.esSpainianawiki7pp..es
praisetotheskiesdefpraisetotheski.eswhois.esSpainianawiki16pp..es
praisewinningdefpraisewinni.ngwhois.ngNigeriaianawiki13pp..ng
praiseworthilydefpraiseworthi.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
praisingdefpraisi.ngwhois.ngNigeriaianawiki8pp..ng
praisinglydefpraising.lywhois.lyLibyan Arab Jamahiriyaianawiki10pp..ly
praisworthilydefpraisworthi.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
prajnadefpraj.nawhois.naNamibiaianawiki6pp..na
prakashdefpraka.shwhois.shSaint Helenaianawiki7pp..sh
prakritdefprakr.itwhois.itItalyianawiki7pp..it
pralinedefprali.newhois.neNigerianawiki7pp..ne
pralinesdefpralin.eswhois.esSpainianawiki8pp..es
pralltrillerdefpralltrill.erwhois.erEritreaianawiki12pp..er
pramdefpr.amwhois.amArmeniaianawiki4pp..am
pramniandefpramni.anwhois.anNetherlands Antillesianawiki8pp..an
pramsdefpra.mswhois.msMontserratianawiki5pp..ms
pranadefpra.nawhois.naNamibiaianawiki5pp..na
pranavadefprana.vawhois.vaHoly See (Vatican City State)ianawiki7pp..va
prancerdefpranc.erwhois.erEritreaianawiki7pp..er
prancesdefpranc.eswhois.esSpainianawiki7pp..es
prancingdefpranci.ngwhois.ngNigeriaianawiki8pp..ng
prancinglydefprancing.lywhois.lyLibyan Arab Jamahiriyaianawiki10pp..ly
prancydefpran.cywhois.cyCyprusianawiki6pp..cy
prandialdefprandi.alwhois.alAlbaniaianawiki8pp..al
prandiallydefprandial.lywhois.lyLibyan Arab Jamahiriyaianawiki10pp..ly
prandtlnumberdefprandtlnumb.erwhois.erEritreaianawiki13pp..er
prangdefpra.ngwhois.ngNigeriaianawiki5pp..ng
prangingdefprangi.ngwhois.ngNigeriaianawiki8pp..ng
prangsdefpran.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki6pp..gs
pranidhanadefpranidha.nawhois.naNamibiaianawiki10pp..na
prankerdefprank.erwhois.erEritreaianawiki7pp..er
prankierdefpranki.erwhois.erEritreaianawiki8pp..er
prankiestdefprankie.stwhois.stSao Tome and Principeianawiki9pp..st
prankingdefpranki.ngwhois.ngNigeriaianawiki8pp..ng
prankinglydefpranking.lywhois.lyLibyan Arab Jamahiriyaianawiki10pp..ly
prankishdefpranki.shwhois.shSaint Helenaianawiki8pp..sh
prankishlydefprankish.lywhois.lyLibyan Arab Jamahiriyaianawiki10pp..ly
pranksterdefprankst.erwhois.erEritreaianawiki9pp..er
prankydefpran.kywhois.kyCayman Islandsianawiki6pp..ky
praodefpr.aowhois.aoAngolaianawiki4pp..ao
prasaddefpras.adwhois.adAndorraianawiki6pp..ad
prasedefpra.sewhois.seSwedenianawiki5pp..se
praseodidymiumdefpraseodidymi.umwhois.umUnited States Minor Outlying Islandsianawiki14pp..um
praseodymiumdefpraseodymi.umwhois.umUnited States Minor Outlying Islandsianawiki12pp..um
prasesdefpras.eswhois.esSpainianawiki6pp..es
prasinedefprasi.newhois.neNigerianawiki7pp..ne
prasinousdefprasino.uswhois.usUnited Statesianawiki9pp..us
prasodefpra.sowhois.soSomaliaianawiki5pp..so
prasoiddefpraso.idwhois.idIndonesiaianawiki7pp..id
prasophagousdefprasophago.uswhois.usUnited Statesianawiki12pp..us
prasophagydefprasopha.gywhois.gyGuyanaianawiki10pp..gy
pratdefpr.atwhois.atAustriaianawiki4pp..at
prataldefprat.alwhois.alAlbaniaianawiki6pp..al
pratdesabadefpratdesa.bawhois.baBosnia and Herzegovinaianawiki10pp..ba
pratensiandefpratensi.anwhois.anNetherlands Antillesianawiki10pp..an
praterdefprat.erwhois.erEritreaianawiki6pp..er
pratesdefprat.eswhois.esSpainianawiki6pp..es
pratfallsdefpratfal.lswhois.lsLesothoianawiki9pp..ls
pratherdefprath.erwhois.erEritreaianawiki7pp..er
pratilomadefpratilo.mawhois.maMoroccoianawiki9pp..ma
pratincoladefpratinco.lawhois.laLao People's Democratic Republicianawiki10pp..la
pratincolinedefpratincoli.newhois.neNigerianawiki12pp..ne
pratincolousdefpratincolo.uswhois.usUnited Statesianawiki12pp..us
pratingdefprati.ngwhois.ngNigeriaianawiki7pp..ng
pratinglydefprating.lywhois.lyLibyan Arab Jamahiriyaianawiki9pp..ly
pratiquesdefpratiqu.eswhois.esSpainianawiki9pp..es
pratodefpra.towhois.toTongaianawiki5pp..to
pratointoscanadefpratointosca.nawhois.naNamibiaianawiki14pp..na
prattdefpra.ttwhois.ttTrinidad and Tobagoianawiki5pp..tt
prattlerdefprattl.erwhois.erEritreaianawiki8pp..er
prattlesdefprattl.eswhois.esSpainianawiki8pp..es
prattlingdefprattli.ngwhois.ngNigeriaianawiki9pp..ng
prattlinglydefprattling.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
prattlydefpratt.lywhois.lyLibyan Arab Jamahiriyaianawiki7pp..ly
praudefpr.auwhois.auAustraliaianawiki4pp..au
prausdefpra.uswhois.usUnited Statesianawiki5pp..us
pravilegedefpravile.gewhois.geGeorgiaianawiki9pp..ge
pravitdefprav.itwhois.itItalyianawiki6pp..it
pravousdefpravo.uswhois.usUnited Statesianawiki7pp..us
prawnerdefprawn.erwhois.erEritreaianawiki7pp..er
prawningdefprawni.ngwhois.ngNigeriaianawiki8pp..ng
praxeandefpraxe.anwhois.anNetherlands Antillesianawiki7pp..an
praxeanistdefpraxeani.stwhois.stSao Tome and Principeianawiki10pp..st
praxeologicaldefpraxeologic.alwhois.alAlbaniaianawiki13pp..al
praxeologydefpraxeolo.gywhois.gyGuyanaianawiki10pp..gy
praxesdefprax.eswhois.esSpainianawiki6pp..es
praxinoscopedefpraxinosco.pewhois.pePeruianawiki12pp..pe
praxiologydefpraxiolo.gywhois.gyGuyanaianawiki10pp..gy
praxisdefprax.iswhois.isIcelandianawiki6pp..is
praxisesdefpraxis.eswhois.esSpainianawiki8pp..es
praxiteleandefpraxitele.anwhois.anNetherlands Antillesianawiki11pp..an
praxitelesdefpraxitel.eswhois.esSpainianawiki10pp..es
praydodefpray.dowhois.doDominican Republicianawiki6pp..do
prayerdefpray.erwhois.erEritreaianawiki6pp..er
prayeransweringdefprayeransweri.ngwhois.ngNigeriaianawiki15pp..ng
prayerbeaddefprayerbe.adwhois.adAndorraianawiki10pp..ad
prayercarpetdefprayercarp.etwhois.etEthiopiaianawiki12pp..et
prayerflagdefprayerfl.agwhois.agAntigua and Barbudaianawiki10pp..ag
prayerfulhopedefprayerfulho.pewhois.pePeruianawiki13pp..pe
prayerfullydefprayerful.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
prayergrantingdefprayergranti.ngwhois.ngNigeriaianawiki14pp..ng
prayerhearingdefprayerheari.ngwhois.ngNigeriaianawiki13pp..ng
prayerlesslydefprayerless.lywhois.lyLibyan Arab Jamahiriyaianawiki12pp..ly
prayerlispingdefprayerlispi.ngwhois.ngNigeriaianawiki13pp..ng
prayerlovingdefprayerlovi.ngwhois.ngNigeriaianawiki12pp..ng
prayermachinedefprayermachi.newhois.neNigerianawiki13pp..ne
prayermakerdefprayermak.erwhois.erEritreaianawiki11pp..er
prayermakingdefprayermaki.ngwhois.ngNigeriaianawiki12pp..ng
prayermatdefprayerm.atwhois.atAustriaianawiki9pp..at
prayermeetingdefprayermeeti.ngwhois.ngNigeriaianawiki13pp..ng
prayerofmanassesdefprayerofmanass.eswhois.esSpainianawiki16pp..es
prayerpaperdefprayerpap.erwhois.erEritreaianawiki11pp..er
prayerrepeatingdefprayerrepeati.ngwhois.ngNigeriaianawiki15pp..ng
prayerrugdefprayerr.ugwhois.ugUgandaianawiki9pp..ug
prayersatfootofthealtardefprayersatfootofthealt.arwhois.arArgentinaianawiki23pp..ar
prayertowerdefprayertow.erwhois.erEritreaianawiki11pp..er
prayerwisedefprayerwi.sewhois.seSwedenianawiki10pp..se
prayforquarterdefprayforquart.erwhois.erEritreaianawiki14pp..er
praygodthatdefpraygodth.atwhois.atAustriaianawiki11pp..at
prayingdefprayi.ngwhois.ngNigeriaianawiki7pp..ng
prayingcylinderdefprayingcylind.erwhois.erEritreaianawiki15pp..er
prayinglydefpraying.lywhois.lyLibyan Arab Jamahiriyaianawiki9pp..ly
prayingmantisdefprayingmant.iswhois.isIcelandianawiki13pp..is
prayingwisedefprayingwi.sewhois.seSwedenianawiki11pp..se
prayoverdefprayov.erwhois.erEritreaianawiki8pp..er
prcadefpr.cawhois.caCanadaianawiki4pp..ca
predefp.rewhois.reReunion Islandianawiki3pp..re
preabundantlydefpreabundant.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
preacceptdefpreacce.ptwhois.ptPortugalianawiki9pp..pt
preacceptancesdefpreacceptanc.eswhois.esSpainianawiki14pp..es
preacceptingdefpreaccepti.ngwhois.ngNigeriaianawiki12pp..ng
preaccidentaldefpreaccident.alwhois.alAlbaniaianawiki13pp..al
preaccidentallydefpreaccidental.lywhois.lyLibyan Arab Jamahiriyaianawiki15pp..ly
preaccommodatingdefpreaccommodati.ngwhois.ngNigeriaianawiki16pp..ng
preaccommodatinglydefpreaccommodating.lywhois.lyLibyan Arab Jamahiriyaianawiki18pp..ly
preaccomplishdefpreaccompli.shwhois.shSaint Helenaianawiki13pp..sh
preaccountingdefpreaccounti.ngwhois.ngNigeriaianawiki13pp..ng
preaccreditdefpreaccred.itwhois.itItalyianawiki11pp..it
preaccumulatingdefpreaccumulati.ngwhois.ngNigeriaianawiki15pp..ng
preaccusedefpreaccu.sewhois.seSwedenianawiki9pp..se
preaccusingdefpreaccusi.ngwhois.ngNigeriaianawiki11pp..ng
preaccustomdefpreaccust.omwhois.omOmanianawiki11pp..om
preaccustomingdefpreaccustomi.ngwhois.ngNigeriaianawiki14pp..ng
preaccustomsdefpreaccusto.mswhois.msMontserratianawiki12pp..ms
preacetabulardefpreacetabul.arwhois.arArgentinaianawiki13pp..ar
preachdefprea.chwhois.chSwitzerlandianawiki6pp..ch
preachaeandefpreachae.anwhois.anNetherlands Antillesianawiki10pp..an
preacherdefpreach.erwhois.erEritreaianawiki8pp..er
preacherdomdefpreacherd.omwhois.omOmanianawiki11pp..om
preacherlingdefpreacherli.ngwhois.ngNigeriaianawiki12pp..ng
preachesdefpreach.eswhois.esSpainianawiki8pp..es
preachierdefpreachi.erwhois.erEritreaianawiki9pp..er
preachiestdefpreachie.stwhois.stSao Tome and Principeianawiki10pp..st
preachifyingdefpreachifyi.ngwhois.ngNigeriaianawiki12pp..ng
preachilydefpreachi.lywhois.lyLibyan Arab Jamahiriyaianawiki9pp..ly
preachingdefpreachi.ngwhois.ngNigeriaianawiki9pp..ng
preachingbrotherdefpreachingbroth.erwhois.erEritreaianawiki16pp..er
preachingfriardefpreachingfri.arwhois.arArgentinaianawiki14pp..ar
preachinghousedefpreachinghou.sewhois.seSwedenianawiki14pp..se
preachinglydefpreaching.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
preachingsdefpreachin.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki10pp..gs
preachmandefpreachm.anwhois.anNetherlands Antillesianawiki9pp..an
preaciddefpreac.idwhois.idIndonesiaianawiki7pp..id
preacidlydefpreacid.lywhois.lyLibyan Arab Jamahiriyaianawiki9pp..ly
preacknowledgedefpreacknowled.gewhois.geGeorgiaianawiki14pp..ge
preacknowledgingdefpreacknowledgi.ngwhois.ngNigeriaianawiki16pp..ng
preacquaintdefpreacqua.intwhois.intInternational Organizationsianawiki11pp..int
preacquiredefpreacqui.rewhois.reReunion Islandianawiki10pp..re
preacquiringdefpreacquiri.ngwhois.ngNigeriaianawiki12pp..ng
preacquisitivedefpreacquisiti.vewhois.veVenezuelaianawiki14pp..ve
preacquisitivelydefpreacquisitive.lywhois.lyLibyan Arab Jamahiriyaianawiki16pp..ly
preacquitdefpreacqu.itwhois.itItalyianawiki9pp..it
preacquittaldefpreacquitt.alwhois.alAlbaniaianawiki12pp..al
preacquittingdefpreacquitti.ngwhois.ngNigeriaianawiki13pp..ng
preactingdefpreacti.ngwhois.ngNigeriaianawiki9pp..ng
preactivedefpreacti.vewhois.veVenezuelaianawiki9pp..ve
preactivelydefpreactive.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
preacutelydefpreacute.lywhois.lyLibyan Arab Jamahiriyaianawiki10pp..ly
preadamiticaldefpreadamitic.alwhois.alAlbaniaianawiki13pp..al
preadamitismdefpreadamiti.smwhois.smSan Marinoianawiki12pp..sm
preadaptdefpreada.ptwhois.ptPortugalianawiki8pp..pt
preadaptingdefpreadapti.ngwhois.ngNigeriaianawiki11pp..ng
preadaptivedefpreadapti.vewhois.veVenezuelaianawiki11pp..ve
preadditionaldefpreaddition.alwhois.alAlbaniaianawiki13pp..al
preadequacydefpreadequa.cywhois.cyCyprusianawiki11pp..cy
preadequatelydefpreadequate.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
preadheredefpreadhe.rewhois.reReunion Islandianawiki9pp..re
preadherentlydefpreadherent.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
preadheringdefpreadheri.ngwhois.ngNigeriaianawiki11pp..ng
preadjectivaldefpreadjectiv.alwhois.alAlbaniaianawiki13pp..al
preadjectivallydefpreadjectival.lywhois.lyLibyan Arab Jamahiriyaianawiki15pp..ly
preadjectivedefpreadjecti.vewhois.veVenezuelaianawiki12pp..ve
preadjustdefpreadju.stwhois.stSao Tome and Principeianawiki9pp..st
preadjustingdefpreadjusti.ngwhois.ngNigeriaianawiki12pp..ng
preadministrativedefpreadministrati.vewhois.veVenezuelaianawiki17pp..ve
preadmiredefpreadmi.rewhois.reReunion Islandianawiki9pp..re
preadmirerdefpreadmir.erwhois.erEritreaianawiki10pp..er
preadmiringdefpreadmiri.ngwhois.ngNigeriaianawiki11pp..ng
preadmitdefpreadm.itwhois.itItalyianawiki8pp..it
preadmittingdefpreadmitti.ngwhois.ngNigeriaianawiki12pp..ng
preadmonishdefpreadmoni.shwhois.shSaint Helenaianawiki11pp..sh
preadolescencesdefpreadolescenc.eswhois.esSpainianawiki15pp..es
preadoptdefpreado.ptwhois.ptPortugalianawiki8pp..pt
preadoptingdefpreadopti.ngwhois.ngNigeriaianawiki11pp..ng
preadoredefpreado.rewhois.reReunion Islandianawiki8pp..re
preadultdefpreadu.ltwhois.ltLithuaniaianawiki8pp..lt
preadventuredefpreadventu.rewhois.reReunion Islandianawiki12pp..re
preadvertencydefpreadverten.cywhois.cyCyprusianawiki13pp..cy
preadvertisedefpreadverti.sewhois.seSwedenianawiki12pp..se
preadvertiserdefpreadvertis.erwhois.erEritreaianawiki13pp..er
preadvertisingdefpreadvertisi.ngwhois.ngNigeriaianawiki14pp..ng
preadvisedefpreadvi.sewhois.seSwedenianawiki9pp..se
preadviserdefpreadvis.erwhois.erEritreaianawiki10pp..er
preadvisingdefpreadvisi.ngwhois.ngNigeriaianawiki11pp..ng
preadvocacydefpreadvoca.cywhois.cyCyprusianawiki11pp..cy
preadvocatingdefpreadvocati.ngwhois.ngNigeriaianawiki13pp..ng
preaestivaldefpreaestiv.alwhois.alAlbaniaianawiki11pp..al
preaffidavitdefpreaffidav.itwhois.itItalyianawiki12pp..it
preaffiliatingdefpreaffiliati.ngwhois.ngNigeriaianawiki14pp..ng
preaffirmativedefpreaffirmati.vewhois.veVenezuelaianawiki14pp..ve
preaffirmingdefpreaffirmi.ngwhois.ngNigeriaianawiki12pp..ng
preaffirmsdefpreaffir.mswhois.msMontserratianawiki10pp..ms
preagedefprea.gewhois.geGeorgiaianawiki6pp..ge
preaggravatingdefpreaggravati.ngwhois.ngNigeriaianawiki14pp..ng
preaggressivedefpreaggressi.vewhois.veVenezuelaianawiki13pp..ve
preaggressivelydefpreaggressive.lywhois.lyLibyan Arab Jamahiriyaianawiki15pp..ly
preagingdefpreagi.ngwhois.ngNigeriaianawiki8pp..ng
preagitatingdefpreagitati.ngwhois.ngNigeriaianawiki12pp..ng
preagonaldefpreagon.alwhois.alAlbaniaianawiki9pp..al
preagreedefpreagr.eewhois.eeEstoniaianawiki8pp..ee
preagreeingdefpreagreei.ngwhois.ngNigeriaianawiki11pp..ng
preagriculturaldefpreagricultur.alwhois.alAlbaniaianawiki15pp..al
preagriculturedefpreagricultu.rewhois.reReunion Islandianawiki14pp..re
preaknessstakesdefpreaknessstak.eswhois.esSpainianawiki15pp..es
prealfrediandefprealfredi.anwhois.anNetherlands Antillesianawiki12pp..an
preallablydefpreallab.lywhois.lyLibyan Arab Jamahiriyaianawiki10pp..ly
preallegedefprealle.gewhois.geGeorgiaianawiki9pp..ge
preallegingdefpreallegi.ngwhois.ngNigeriaianawiki11pp..ng
prealliesdefprealli.eswhois.esSpainianawiki9pp..es
preallocatesdefpreallocat.eswhois.esSpainianawiki12pp..es
preallocatingdefpreallocati.ngwhois.ngNigeriaianawiki13pp..ng
preallottingdefpreallotti.ngwhois.ngNigeriaianawiki12pp..ng
preallowablydefpreallowab.lywhois.lyLibyan Arab Jamahiriyaianawiki12pp..ly
prealludedefpreallu.dewhois.deGermanyianawiki9pp..de
prealludingdefprealludi.ngwhois.ngNigeriaianawiki11pp..ng
preallydefpreal.lywhois.lyLibyan Arab Jamahiriyaianawiki7pp..ly
preallyingdefpreallyi.ngwhois.ngNigeriaianawiki10pp..ng
prealphabetdefprealphab.etwhois.etEthiopiaianawiki11pp..et
prealphabeticaldefprealphabetic.alwhois.alAlbaniaianawiki15pp..al
prealphabeticallydefprealphabetical.lywhois.lyLibyan Arab Jamahiriyaianawiki17pp..ly
prealtardefprealt.arwhois.arArgentinaianawiki8pp..ar
prealterdefprealt.erwhois.erEritreaianawiki8pp..er
prealternatemoltdefprealternatemo.ltwhois.ltLithuaniaianawiki16pp..lt
prealveolardefprealveol.arwhois.arArgentinaianawiki11pp..ar
preambassadorialdefpreambassadori.alwhois.alAlbaniaianawiki16pp..al
preambitiousdefpreambitio.uswhois.usUnited Statesianawiki12pp..us
preambitiouslydefpreambitious.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
preamblesdefpreambl.eswhois.esSpainianawiki9pp..es
preamblingdefpreambli.ngwhois.ngNigeriaianawiki10pp..ng
preambulardefpreambul.arwhois.arArgentinaianawiki10pp..ar
preamericandefpreameric.anwhois.anNetherlands Antillesianawiki11pp..an
preammonitishdefpreammoniti.shwhois.shSaint Helenaianawiki13pp..sh
preampdefprea.mpwhois.mpNorthern Mariana Islandsianawiki6pp..mp
preamplifierdefpreamplifi.erwhois.erEritreaianawiki12pp..er
preampsdefpream.pswhois.psPalestinian Territory (Occupied)ianawiki7pp..ps
preanaldefprean.alwhois.alAlbaniaianawiki7pp..al
preanaphoraldefpreanaphor.alwhois.alAlbaniaianawiki12pp..al
preanestheticsdefpreanestheti.cswhois.csSerbia and Montenegroianawiki14pp..cs
preanimismdefpreanimi.smwhois.smSan Marinoianawiki10pp..sm
preannouncerdefpreannounc.erwhois.erEritreaianawiki12pp..er
preannouncesdefpreannounc.eswhois.esSpainianawiki12pp..es
preannouncingdefpreannounci.ngwhois.ngNigeriaianawiki13pp..ng
preantepenultdefpreantepenu.ltwhois.ltLithuaniaianawiki13pp..lt
preanticipatingdefpreanticipati.ngwhois.ngNigeriaianawiki15pp..ng
preappearancesdefpreappearanc.eswhois.esSpainianawiki14pp..es
preapplydefpreapp.lywhois.lyLibyan Arab Jamahiriyaianawiki8pp..ly
preapplyingdefpreapplyi.ngwhois.ngNigeriaianawiki11pp..ng
preappointdefpreappo.intwhois.intInternational Organizationsianawiki10pp..int
preappointingdefpreappointi.ngwhois.ngNigeriaianawiki13pp..ng
preapprisedefpreappri.sewhois.seSwedenianawiki10pp..se
preapprisingdefpreapprisi.ngwhois.ngNigeriaianawiki12pp..ng
preapprizingdefpreapprizi.ngwhois.ngNigeriaianawiki12pp..ng
preapprovaldefpreapprov.alwhois.alAlbaniaianawiki11pp..al
preapprovedefpreappro.vewhois.veVenezuelaianawiki10pp..ve
preapprovingdefpreapprovi.ngwhois.ngNigeriaianawiki12pp..ng
preaptitudedefpreaptitu.dewhois.deGermanyianawiki11pp..de
prearmingdefprearmi.ngwhois.ngNigeriaianawiki9pp..ng
prearmsdefprear.mswhois.msMontserratianawiki7pp..ms
prearrangedefprearran.gewhois.geGeorgiaianawiki10pp..ge
prearrangesdefprearrang.eswhois.esSpainianawiki11pp..es
prearrangingdefprearrangi.ngwhois.ngNigeriaianawiki12pp..ng
prearrestdefprearre.stwhois.stSao Tome and Principeianawiki9pp..st
prearthuriandefprearthuri.anwhois.anNetherlands Antillesianawiki12pp..an
prearyandefpreary.anwhois.anNetherlands Antillesianawiki8pp..an
preascertaindefpreascerta.inwhois.inIndiaianawiki12pp..in
preascertainingdefpreascertaini.ngwhois.ngNigeriaianawiki15pp..ng
preassemblesdefpreassembl.eswhois.esSpainianawiki12pp..es
preassemblingdefpreassembli.ngwhois.ngNigeriaianawiki13pp..ng
preassemblydefpreassemb.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
preassigndefpreassi.gnwhois.gnGuineaianawiki9pp..gn
preassigningdefpreassigni.ngwhois.ngNigeriaianawiki12pp..ng
preassumingdefpreassumi.ngwhois.ngNigeriaianawiki11pp..ng
preassuredefpreassu.rewhois.reReunion Islandianawiki9pp..re
preassuringdefpreassuri.ngwhois.ngNigeriaianawiki11pp..ng
preassyriandefpreassyri.anwhois.anNetherlands Antillesianawiki11pp..an
preattunedefpreattu.newhois.neNigerianawiki9pp..ne
preattuningdefpreattuni.ngwhois.ngNigeriaianawiki11pp..ng
preauditdefpreaud.itwhois.itItalyianawiki8pp..it
preaugustandefpreaugust.anwhois.anNetherlands Antillesianawiki11pp..an
preaugustinedefpreaugusti.newhois.neNigerianawiki12pp..ne
preauriculardefpreauricul.arwhois.arArgentinaianawiki12pp..ar
preauthorizesdefpreauthoriz.eswhois.esSpainianawiki13pp..es
preauthorizingdefpreauthorizi.ngwhois.ngNigeriaianawiki14pp..ng
preaverdefpreav.erwhois.erEritreaianawiki7pp..er
preaverringdefpreaverri.ngwhois.ngNigeriaianawiki11pp..ng
preavowaldefpreavow.alwhois.alAlbaniaianawiki9pp..al
preaxiaddefpreaxi.adwhois.adAndorraianawiki8pp..ad
preaxialdefpreaxi.alwhois.alAlbaniaianawiki8pp..al
preaxiallydefpreaxial.lywhois.lyLibyan Arab Jamahiriyaianawiki10pp..ly
prebabyloniandefprebabyloni.anwhois.anNetherlands Antillesianawiki13pp..an
prebaconiandefprebaconi.anwhois.anNetherlands Antillesianawiki11pp..an
prebadedefpreba.dewhois.deGermanyianawiki7pp..de
prebakedefpreba.kewhois.keKenyaianawiki7pp..ke
prebalancingdefprebalanci.ngwhois.ngNigeriaianawiki12pp..ng
preballotingdefpreballoti.ngwhois.ngNigeriaianawiki12pp..ng
prebankruptcydefprebankrupt.cywhois.cyCyprusianawiki13pp..cy
prebaptismaldefprebaptism.alwhois.alAlbaniaianawiki12pp..al
prebarbaricallydefprebarbarical.lywhois.lyLibyan Arab Jamahiriyaianawiki15pp..ly
prebarbarousdefprebarbaro.uswhois.usUnited Statesianawiki12pp..us
prebarbarouslydefprebarbarous.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
prebargaindefprebarga.inwhois.inIndiaianawiki10pp..in
prebasaldefprebas.alwhois.alAlbaniaianawiki8pp..al
prebasicmoltdefprebasicmo.ltwhois.ltLithuaniaianawiki12pp..lt
prebasilardefprebasil.arwhois.arArgentinaianawiki10pp..ar
prebelevedefprebele.vewhois.veVenezuelaianawiki9pp..ve
prebelievedefprebelie.vewhois.veVenezuelaianawiki10pp..ve
prebelieverdefprebeliev.erwhois.erEritreaianawiki11pp..er
prebelievingdefprebelievi.ngwhois.ngNigeriaianawiki12pp..ng
prebellumdefprebell.umwhois.umUnited States Minor Outlying Islandsianawiki9pp..um
prebendaldefprebend.alwhois.alAlbaniaianawiki9pp..al
prebendariesdefprebendari.eswhois.esSpainianawiki12pp..es
prebeneficiariesdefprebeneficiari.eswhois.esSpainianawiki16pp..es
prebenefitdefprebenef.itwhois.itItalyianawiki10pp..it
prebenefitingdefprebenefiti.ngwhois.ngNigeriaianawiki13pp..ng
prebesetdefprebes.etwhois.etEthiopiaianawiki8pp..et
prebesettingdefprebesetti.ngwhois.ngNigeriaianawiki12pp..ng
prebestowaldefprebestow.alwhois.alAlbaniaianawiki11pp..al
prebetrayaldefprebetray.alwhois.alAlbaniaianawiki11pp..al
prebetrothaldefprebetroth.alwhois.alAlbaniaianawiki12pp..al
prebiblicaldefprebiblic.alwhois.alAlbaniaianawiki11pp..al
prebiddefpreb.idwhois.idIndonesiaianawiki6pp..id
prebiddingdefprebiddi.ngwhois.ngNigeriaianawiki10pp..ng
prebillingdefprebilli.ngwhois.ngNigeriaianawiki10pp..ng
prebillsdefprebil.lswhois.lsLesothoianawiki8pp..ls
prebindingdefprebindi.ngwhois.ngNigeriaianawiki10pp..ng
prebiologicaldefprebiologic.alwhois.alAlbaniaianawiki13pp..al
preblessesdefprebless.eswhois.esSpainianawiki10pp..es
preblessingdefpreblessi.ngwhois.ngNigeriaianawiki11pp..ng
preblockadedefpreblocka.dewhois.deGermanyianawiki11pp..de
preblockadingdefpreblockadi.ngwhois.ngNigeriaianawiki13pp..ng
prebloomingdefprebloomi.ngwhois.ngNigeriaianawiki11pp..ng
prebodefpre.bowhois.boBoliviaianawiki5pp..bo
preboastdefpreboa.stwhois.stSao Tome and Principeianawiki8pp..st
prebodingdefprebodi.ngwhois.ngNigeriaianawiki9pp..ng
preboildefprebo.ilwhois.ilIsraelianawiki7pp..il
preboilingdefpreboili.ngwhois.ngNigeriaianawiki10pp..ng
preboilsdefpreboi.lswhois.lsLesothoianawiki8pp..ls
preboomdefprebo.omwhois.omOmanianawiki7pp..om
preborrowingdefpreborrowi.ngwhois.ngNigeriaianawiki12pp..ng
prebrachialdefprebrachi.alwhois.alAlbaniaianawiki11pp..al
prebrachiumdefprebrachi.umwhois.umUnited States Minor Outlying Islandsianawiki11pp..um
prebranchialdefprebranchi.alwhois.alAlbaniaianawiki12pp..al
prebreakfastdefprebreakfa.stwhois.stSao Tome and Principeianawiki12pp..st
prebreathingdefprebreathi.ngwhois.ngNigeriaianawiki12pp..ng
prebridaldefprebrid.alwhois.alAlbaniaianawiki9pp..al
prebritishdefprebriti.shwhois.shSaint Helenaianawiki10pp..sh
prebroadcastingdefprebroadcasti.ngwhois.ngNigeriaianawiki15pp..ng
prebronchialdefprebronchi.alwhois.alAlbaniaianawiki12pp..al
prebuccaldefprebucc.alwhois.alAlbaniaianawiki9pp..al
prebuddhistdefprebuddhi.stwhois.stSao Tome and Principeianawiki11pp..st
prebudgetdefprebudg.etwhois.etEthiopiaianawiki9pp..et
prebullyingdefprebullyi.ngwhois.ngNigeriaianawiki11pp..ng
prebyzantinedefprebyzanti.newhois.neNigerianawiki12pp..ne
precdefpr.ecwhois.ecEcuadorianawiki4pp..ec
precalculatesdefprecalculat.eswhois.esSpainianawiki13pp..es
precalculatingdefprecalculati.ngwhois.ngNigeriaianawiki14pp..ng
precalculusdefprecalcul.uswhois.usUnited Statesianawiki11pp..us
precalculusesdefprecalculus.eswhois.esSpainianawiki13pp..es
precambriandefprecambri.anwhois.anNetherlands Antillesianawiki11pp..an
precambridgedefprecambrid.gewhois.geGeorgiaianawiki12pp..ge
precampaigndefprecampai.gnwhois.gnGuineaianawiki11pp..gn
precancelingdefprecanceli.ngwhois.ngNigeriaianawiki12pp..ng
precancellingdefprecancelli.ngwhois.ngNigeriaianawiki13pp..ng
precancelsdefprecance.lswhois.lsLesothoianawiki10pp..ls
precancerousdefprecancero.uswhois.usUnited Statesianawiki12pp..us
precandidacydefprecandida.cywhois.cyCyprusianawiki12pp..cy
precandidaturedefprecandidatu.rewhois.reReunion Islandianawiki14pp..re
precanningdefprecanni.ngwhois.ngNigeriaianawiki10pp..ng
precanonicaldefprecanonic.alwhois.alAlbaniaianawiki12pp..al
precapitalistdefprecapitali.stwhois.stSao Tome and Principeianawiki13pp..st
precapturedefprecaptu.rewhois.reReunion Islandianawiki10pp..re
precapturingdefprecapturi.ngwhois.ngNigeriaianawiki12pp..ng
precarboniferousdefprecarbonifero.uswhois.usUnited Statesianawiki16pp..us
precarcinomatousdefprecarcinomato.uswhois.usUnited Statesianawiki16pp..us
precardiacdefprecardi.acwhois.acAscension Islandianawiki10pp..ac
precariousdefprecario.uswhois.usUnited Statesianawiki10pp..us
precariouslydefprecarious.lywhois.lyLibyan Arab Jamahiriyaianawiki12pp..ly
precariousnessesdefprecariousness.eswhois.esSpainianawiki16pp..es
precariumdefprecari.umwhois.umUnited States Minor Outlying Islandsianawiki9pp..um
precarnivaldefprecarniv.alwhois.alAlbaniaianawiki11pp..al
precarolingiandefprecarolingi.anwhois.anNetherlands Antillesianawiki14pp..an
precartilagedefprecartila.gewhois.geGeorgiaianawiki12pp..ge
precartilaginousdefprecartilagino.uswhois.usUnited Statesianawiki16pp..us
precastdefpreca.stwhois.stSao Tome and Principeianawiki7pp..st
precastingdefprecasti.ngwhois.ngNigeriaianawiki10pp..ng
precativedefprecati.vewhois.veVenezuelaianawiki9pp..ve
precativelydefprecative.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
precaudaldefprecaud.alwhois.alAlbaniaianawiki9pp..al
precautionaldefprecaution.alwhois.alAlbaniaianawiki12pp..al
precautioningdefprecautioni.ngwhois.ngNigeriaianawiki13pp..ng
precautiousdefprecautio.uswhois.usUnited Statesianawiki11pp..us
precautiouslydefprecautious.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
precavadefpreca.vawhois.vaHoly See (Vatican City State)ianawiki7pp..va
precavaedefprecav.aewhois.aeUnited Arab Emiratesianawiki8pp..ae
precavaldefprecav.alwhois.alAlbaniaianawiki8pp..al
precchosedefpreccho.sewhois.seSwedenianawiki9pp..se
precedaneousdefprecedaneo.uswhois.usUnited Statesianawiki12pp..us
precededefprece.dewhois.deGermanyianawiki7pp..de
precedencesdefprecedenc.eswhois.esSpainianawiki11pp..es
precedenciesdefprecedenci.eswhois.esSpainianawiki12pp..es
precedencydefpreceden.cywhois.cyCyprusianawiki10pp..cy
precedentialdefprecedenti.alwhois.alAlbaniaianawiki12pp..al
precedentlydefprecedent.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
precederdefpreced.erwhois.erEritreaianawiki8pp..er
precedesdefpreced.eswhois.esSpainianawiki8pp..es
precedingdefprecedi.ngwhois.ngNigeriaianawiki9pp..ng
preceedingdefpreceedi.ngwhois.ngNigeriaianawiki10pp..ng
precelebratingdefprecelebrati.ngwhois.ngNigeriaianawiki14pp..ng
precensuredefprecensu.rewhois.reReunion Islandianawiki10pp..re
precensuringdefprecensuri.ngwhois.ngNigeriaianawiki12pp..ng
precensusdefprecens.uswhois.usUnited Statesianawiki9pp..us
precentennialdefprecentenni.alwhois.alAlbaniaianawiki13pp..al
precentingdefprecenti.ngwhois.ngNigeriaianawiki10pp..ng
precentorialdefprecentori.alwhois.alAlbaniaianawiki12pp..al
precentraldefprecentr.alwhois.alAlbaniaianawiki10pp..al
precentrumdefprecentr.umwhois.umUnited States Minor Outlying Islandsianawiki10pp..um
preceptdefprece.ptwhois.ptPortugalianawiki7pp..pt
preceptistdefprecepti.stwhois.stSao Tome and Principeianawiki10pp..st
preceptivedefprecepti.vewhois.veVenezuelaianawiki10pp..ve
preceptivelydefpreceptive.lywhois.lyLibyan Arab Jamahiriyaianawiki12pp..ly
preceptoraldefpreceptor.alwhois.alAlbaniaianawiki11pp..al
preceptorialdefpreceptori.alwhois.alAlbaniaianawiki12pp..al
preceptoriallydefpreceptorial.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
preceptoriesdefpreceptori.eswhois.esSpainianawiki12pp..es
preceptressesdefpreceptress.eswhois.esSpainianawiki13pp..es
preceptualdefpreceptu.alwhois.alAlbaniaianawiki10pp..al
preceptuallydefpreceptual.lywhois.lyLibyan Arab Jamahiriyaianawiki12pp..ly
precerebellardefprecerebell.arwhois.arArgentinaianawiki13pp..ar
precerebraldefprecerebr.alwhois.alAlbaniaianawiki11pp..al
precerebroiddefprecerebro.idwhois.idIndonesiaianawiki12pp..id
preceremonialdefpreceremoni.alwhois.alAlbaniaianawiki13pp..al
preceremoniesdefpreceremoni.eswhois.esSpainianawiki13pp..es
precertifyingdefprecertifyi.ngwhois.ngNigeriaianawiki13pp..ng
precesdefprec.eswhois.esSpainianawiki6pp..es
precessesdefprecess.eswhois.esSpainianawiki9pp..es
precessingdefprecessi.ngwhois.ngNigeriaianawiki10pp..ng
precessionaldefprecession.alwhois.alAlbaniaianawiki12pp..al
precessionoftheequinoxesdefprecessionoftheequinox.eswhois.esSpainianawiki24pp..es
prechallengedefprechallen.gewhois.geGeorgiaianawiki12pp..ge
prechallengingdefprechallengi.ngwhois.ngNigeriaianawiki14pp..ng
prechargedefprechar.gewhois.geGeorgiaianawiki9pp..ge
prechargingdefprechargi.ngwhois.ngNigeriaianawiki11pp..ng
prechauceriandefprechauceri.anwhois.anNetherlands Antillesianawiki13pp..an
precheckdefpreche.ckwhois.ckCook Islandsianawiki8pp..ck
precheckingdefprechecki.ngwhois.ngNigeriaianawiki11pp..ng
prechelleandefprechelle.anwhois.anNetherlands Antillesianawiki11pp..an
prechemicaldefprechemic.alwhois.alAlbaniaianawiki11pp..al
precherishdefprecheri.shwhois.shSaint Helenaianawiki10pp..sh
prechillingdefprechilli.ngwhois.ngNigeriaianawiki11pp..ng
prechillsdefprechil.lswhois.lsLesothoianawiki9pp..ls
prechinesedefprechine.sewhois.seSwedenianawiki10pp..se
prechoosedefprechoo.sewhois.seSwedenianawiki9pp..se
prechoosingdefprechoosi.ngwhois.ngNigeriaianawiki11pp..ng
prechordaldefprechord.alwhois.alAlbaniaianawiki10pp..al
prechoroiddefprechoro.idwhois.idIndonesiaianawiki10pp..id
prechosedefprecho.sewhois.seSwedenianawiki8pp..se
prechristiandefprechristi.anwhois.anNetherlands Antillesianawiki12pp..an
prechristmasdefprechristm.aswhois.asAmerican Samoaianawiki12pp..as
precidedefpreci.dewhois.deGermanyianawiki7pp..de
precieusedefprecieu.sewhois.seSwedenianawiki9pp..se
precinctcaptaindefprecinctcapta.inwhois.inIndiaianawiki15pp..in
precincthousedefprecincthou.sewhois.seSwedenianawiki13pp..se
precinctivedefprecincti.vewhois.veVenezuelaianawiki11pp..ve
precinctleaderdefprecinctlead.erwhois.erEritreaianawiki14pp..er
preciosadefprecio.sawhois.saSaudi Arabiaianawiki8pp..sa
preciositiesdefpreciositi.eswhois.esSpainianawiki12pp..es
preciousdefprecio.uswhois.usUnited Statesianawiki8pp..us
preciouscoraldefpreciouscor.alwhois.alAlbaniaianawiki13pp..al
preciousesdefprecious.eswhois.esSpainianawiki10pp..es
preciouslydefprecious.lywhois.lyLibyan Arab Jamahiriyaianawiki10pp..ly
preciousmetaldefpreciousmet.alwhois.alAlbaniaianawiki13pp..al
preciousmetalsdefpreciousmeta.lswhois.lsLesothoianawiki14pp..ls
preciousmoonstonedefpreciousmoonsto.newhois.neNigerianawiki17pp..ne
preciousopaldefpreciousop.alwhois.alAlbaniaianawiki12pp..al
preciousrascaldefpreciousrasc.alwhois.alAlbaniaianawiki14pp..al
preciousstonedefprecioussto.newhois.neNigerianawiki13pp..ne
precipedefpreci.pewhois.pePeruianawiki7pp..pe
precipesdefprecip.eswhois.esSpainianawiki8pp..es
precipicesdefprecipic.eswhois.esSpainianawiki10pp..es
precipitablewaterdefprecipitablewat.erwhois.erEritreaianawiki17pp..er
precipitanciesdefprecipitanci.eswhois.esSpainianawiki14pp..es
precipitancydefprecipitan.cywhois.cyCyprusianawiki12pp..cy
precipitantlydefprecipitant.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
precipitatedlydefprecipitated.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
precipitatelydefprecipitate.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
precipitatenessesdefprecipitateness.eswhois.esSpainianawiki17pp..es
precipitatesdefprecipitat.eswhois.esSpainianawiki12pp..es
precipitatingdefprecipitati.ngwhois.ngNigeriaianawiki13pp..ng
precipitationhardeningdefprecipitationhardeni.ngwhois.ngNigeriaianawiki22pp..ng
precipitativedefprecipitati.vewhois.veVenezuelaianawiki13pp..ve
precipitindefprecipit.inwhois.inIndiaianawiki10pp..in
precipitousdefprecipito.uswhois.usUnited Statesianawiki11pp..us
precipitouslydefprecipitous.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
precirculatingdefprecirculati.ngwhois.ngNigeriaianawiki14pp..ng
precisdefprec.iswhois.isIcelandianawiki6pp..is
precisedefpreci.sewhois.seSwedenianawiki7pp..se
preciselydefprecise.lywhois.lyLibyan Arab Jamahiriyaianawiki9pp..ly
precisenessesdefpreciseness.eswhois.esSpainianawiki13pp..es
preciserdefprecis.erwhois.erEritreaianawiki8pp..er
precisesdefprecis.eswhois.esSpainianawiki8pp..es
precisestdefprecise.stwhois.stSao Tome and Principeianawiki9pp..st
precisiandefprecisi.anwhois.anNetherlands Antillesianawiki9pp..an
precisianismdefprecisiani.smwhois.smSan Marinoianawiki12pp..sm
precisianistdefprecisiani.stwhois.stSao Tome and Principeianawiki12pp..st
precisingdefprecisi.ngwhois.ngNigeriaianawiki9pp..ng
precisionaldefprecision.alwhois.alAlbaniaianawiki11pp..al
precisionbarometerdefprecisionbaromet.erwhois.erEritreaianawiki18pp..er
precisionblockdefprecisionblo.ckwhois.ckCook Islandsianawiki14pp..ck
precisionbomberdefprecisionbomb.erwhois.erEritreaianawiki15pp..er
precisionbombingdefprecisionbombi.ngwhois.ngNigeriaianawiki16pp..ng
precisioncaliperdefprecisioncalip.erwhois.erEritreaianawiki16pp..er
precisioncastingdefprecisioncasti.ngwhois.ngNigeriaianawiki16pp..ng
precisionclockdefprecisionclo.ckwhois.ckCook Islandsianawiki14pp..ck
precisionerdefprecision.erwhois.erEritreaianawiki11pp..er
precisionfocusingdefprecisionfocusi.ngwhois.ngNigeriaianawiki17pp..ng
precisiongaugedefprecisiongau.gewhois.geGeorgiaianawiki14pp..ge
precisiongaugeblockdefprecisiongaugeblo.ckwhois.ckCook Islandsianawiki19pp..ck
precisiongrindingdefprecisiongrindi.ngwhois.ngNigeriaianawiki17pp..ng
precisionismdefprecisioni.smwhois.smSan Marinoianawiki12pp..sm
precisionistdefprecisioni.stwhois.stSao Tome and Principeianawiki12pp..st
precisionmeterdefprecisionmet.erwhois.erEritreaianawiki14pp..er
precisionpunchdefprecisionpun.chwhois.chSwitzerlandianawiki14pp..ch
precisionweightdefprecisionweig.htwhois.htHaitiianawiki15pp..ht
precisivedefprecisi.vewhois.veVenezuelaianawiki9pp..ve
precisodefpreci.sowhois.soSomaliaianawiki7pp..so
precitingdefpreciti.ngwhois.ngNigeriaianawiki9pp..ng
preclaimdefprecla.imwhois.imIsle of Manianawiki8pp..im
preclaimerdefpreclaim.erwhois.erEritreaianawiki10pp..er
preclaredefprecla.rewhois.reReunion Islandianawiki8pp..re
preclassicaldefpreclassic.alwhois.alAlbaniaianawiki12pp..al
preclassicallydefpreclassical.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
preclassifyingdefpreclassifyi.ngwhois.ngNigeriaianawiki14pp..ng
precleandefprecle.anwhois.anNetherlands Antillesianawiki8pp..an
precleanerdefpreclean.erwhois.erEritreaianawiki10pp..er
precleaningdefprecleani.ngwhois.ngNigeriaianawiki11pp..ng
precleardefprecle.arwhois.arArgentinaianawiki8pp..ar
preclearancesdefpreclearanc.eswhois.esSpainianawiki13pp..es
preclericaldefprecleric.alwhois.alAlbaniaianawiki11pp..al
preclimaxdefpreclim.axwhois.axAland Islandsianawiki9pp..ax
preclinicaldefpreclinic.alwhois.alAlbaniaianawiki11pp..al
preclinicalmedicinedefpreclinicalmedici.newhois.neNigerianawiki19pp..ne
preclivaldefprecliv.alwhois.alAlbaniaianawiki9pp..al
precloacaldefprecloac.alwhois.alAlbaniaianawiki10pp..al
preclosedefpreclo.sewhois.seSwedenianawiki8pp..se
preclosingdefpreclosi.ngwhois.ngNigeriaianawiki10pp..ng
preclosuredefpreclosu.rewhois.reReunion Islandianawiki10pp..re
preclothingdefpreclothi.ngwhois.ngNigeriaianawiki11pp..ng
precludedefpreclu.dewhois.deGermanyianawiki8pp..de
precludesdefpreclud.eswhois.esSpainianawiki9pp..es
precludingdefprecludi.ngwhois.ngNigeriaianawiki10pp..ng
preclusivedefpreclusi.vewhois.veVenezuelaianawiki10pp..ve
preclusivelydefpreclusive.lywhois.lyLibyan Arab Jamahiriyaianawiki12pp..ly
precoccygealdefprecoccyge.alwhois.alAlbaniaianawiki12pp..al
precocialdefprecoci.alwhois.alAlbaniaianawiki9pp..al
precociousdefprecocio.uswhois.usUnited Statesianawiki10pp..us
precociouslydefprecocious.lywhois.lyLibyan Arab Jamahiriyaianawiki12pp..ly
precocitiesdefprecociti.eswhois.esSpainianawiki11pp..es
precodedefpreco.dewhois.deGermanyianawiki7pp..de
precodesdefprecod.eswhois.esSpainianawiki8pp..es
precogitatingdefprecogitati.ngwhois.ngNigeriaianawiki13pp..ng
precognitivedefprecogniti.vewhois.veVenezuelaianawiki12pp..ve
precognizingdefprecognizi.ngwhois.ngNigeriaianawiki12pp..ng
precoildefpreco.ilwhois.ilIsraelianawiki7pp..il
precoilerdefprecoil.erwhois.erEritreaianawiki9pp..er
precoincidentlydefprecoincident.lywhois.lyLibyan Arab Jamahiriyaianawiki15pp..ly
precollapsedefprecollap.sewhois.seSwedenianawiki11pp..se
precollapsingdefprecollapsi.ngwhois.ngNigeriaianawiki13pp..ng
precollegedefprecolle.gewhois.geGeorgiaianawiki10pp..ge
precolludedefprecollu.dewhois.deGermanyianawiki10pp..de
precolludingdefprecolludi.ngwhois.ngNigeriaianawiki12pp..ng
precollusivedefprecollusi.vewhois.veVenezuelaianawiki12pp..ve
precolonialdefprecoloni.alwhois.alAlbaniaianawiki11pp..al
precoloringdefprecolori.ngwhois.ngNigeriaianawiki11pp..ng
precolumbiandefprecolumbi.anwhois.anNetherlands Antillesianawiki12pp..an
precombatdefprecomb.atwhois.atAustriaianawiki9pp..at
precombatingdefprecombati.ngwhois.ngNigeriaianawiki12pp..ng
precombinedefprecombi.newhois.neNigerianawiki10pp..ne
precombiningdefprecombini.ngwhois.ngNigeriaianawiki12pp..ng
precombustionenginedefprecombustionengi.newhois.neNigerianawiki19pp..ne
precommercialdefprecommerci.alwhois.alAlbaniaianawiki13pp..al
precommissuraldefprecommissur.alwhois.alAlbaniaianawiki14pp..al
precommissuredefprecommissu.rewhois.reReunion Islandianawiki13pp..re
precommitdefprecomm.itwhois.itItalyianawiki9pp..it
precommittingdefprecommitti.ngwhois.ngNigeriaianawiki13pp..ng
precommunedefprecommu.newhois.neNigerianawiki10pp..ne
precommunicatingdefprecommunicati.ngwhois.ngNigeriaianawiki16pp..ng
precommuningdefprecommuni.ngwhois.ngNigeriaianawiki12pp..ng
precomparedefprecompa.rewhois.reReunion Islandianawiki10pp..re
precomparingdefprecompari.ngwhois.ngNigeriaianawiki12pp..ng
precompellingdefprecompelli.ngwhois.ngNigeriaianawiki13pp..ng
precompensatingdefprecompensati.ngwhois.ngNigeriaianawiki15pp..ng
precompilerdefprecompil.erwhois.erEritreaianawiki11pp..er
precompilingdefprecompili.ngwhois.ngNigeriaianawiki12pp..ng
precomplicatingdefprecomplicati.ngwhois.ngNigeriaianawiki15pp..ng
precomposedefprecompo.sewhois.seSwedenianawiki10pp..se
precompoundingdefprecompoundi.ngwhois.ngNigeriaianawiki14pp..ng
precompoundlydefprecompound.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
precomprehensivedefprecomprehensi.vewhois.veVenezuelaianawiki16pp..ve
precomprehensivelydefprecomprehensive.lywhois.lyLibyan Arab Jamahiriyaianawiki18pp..ly
precomputesdefprecomput.eswhois.esSpainianawiki11pp..es
precomputingdefprecomputi.ngwhois.ngNigeriaianawiki12pp..ng
preconcealdefpreconce.alwhois.alAlbaniaianawiki10pp..al
preconcealingdefpreconceali.ngwhois.ngNigeriaianawiki13pp..ng
preconcealsdefpreconcea.lswhois.lsLesothoianawiki11pp..ls
preconcededefpreconce.dewhois.deGermanyianawiki10pp..de
preconcedingdefpreconcedi.ngwhois.ngNigeriaianawiki12pp..ng
preconceivedefpreconcei.vewhois.veVenezuelaianawiki11pp..ve
preconceivesdefpreconceiv.eswhois.esSpainianawiki12pp..es
preconceivingdefpreconceivi.ngwhois.ngNigeriaianawiki13pp..ng
preconcentratedlydefpreconcentrated.lywhois.lyLibyan Arab Jamahiriyaianawiki17pp..ly
preconcentratingdefpreconcentrati.ngwhois.ngNigeriaianawiki16pp..ng
preconceptdefpreconce.ptwhois.ptPortugalianawiki10pp..pt
preconceptionaldefpreconception.alwhois.alAlbaniaianawiki15pp..al
preconceptualdefpreconceptu.alwhois.alAlbaniaianawiki13pp..al
preconcertedlydefpreconcerted.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
preconcertivedefpreconcerti.vewhois.veVenezuelaianawiki13pp..ve
preconcessivedefpreconcessi.vewhois.veVenezuelaianawiki13pp..ve
preconcludedefpreconclu.dewhois.deGermanyianawiki11pp..de
preconcludingdefpreconcludi.ngwhois.ngNigeriaianawiki13pp..ng
preconcurrentlydefpreconcurrent.lywhois.lyLibyan Arab Jamahiriyaianawiki15pp..ly
preconcurringdefpreconcurri.ngwhois.ngNigeriaianawiki13pp..ng
precondemndefpreconde.mnwhois.mnMongoliaianawiki10pp..mn
precondemningdefprecondemni.ngwhois.ngNigeriaianawiki13pp..ng
precondensedefpreconden.sewhois.seSwedenianawiki11pp..se
precondensingdefprecondensi.ngwhois.ngNigeriaianawiki13pp..ng
preconditioningdefpreconditioni.ngwhois.ngNigeriaianawiki15pp..ng
precondylardefprecondyl.arwhois.arArgentinaianawiki11pp..ar
precondyloiddefprecondylo.idwhois.idIndonesiaianawiki12pp..id
preconferdefpreconf.erwhois.erEritreaianawiki9pp..er
preconferringdefpreconferri.ngwhois.ngNigeriaianawiki13pp..ng
preconfidedefpreconfi.dewhois.deGermanyianawiki10pp..de
preconfidingdefpreconfidi.ngwhois.ngNigeriaianawiki12pp..ng
preconfiguredefpreconfigu.rewhois.reReunion Islandianawiki12pp..re
preconfiguringdefpreconfiguri.ngwhois.ngNigeriaianawiki14pp..ng
preconfinedefpreconfi.newhois.neNigerianawiki10pp..ne
preconfinedlydefpreconfined.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
preconfiningdefpreconfini.ngwhois.ngNigeriaianawiki12pp..ng
preconfusedefpreconfu.sewhois.seSwedenianawiki10pp..se
preconfusedlydefpreconfused.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
preconfusingdefpreconfusi.ngwhois.ngNigeriaianawiki12pp..ng
precongenialdefprecongeni.alwhois.alAlbaniaianawiki12pp..al
precongestivedefprecongesti.vewhois.veVenezuelaianawiki13pp..ve
precongratulatingdefprecongratulati.ngwhois.ngNigeriaianawiki17pp..ng
precongregationalistdefprecongregationali.stwhois.stSao Tome and Principeianawiki20pp..st
precongressionaldefprecongression.alwhois.alAlbaniaianawiki16pp..al
preconisedefpreconi.sewhois.seSwedenianawiki9pp..se
preconizerdefpreconiz.erwhois.erEritreaianawiki10pp..er
preconizingdefpreconizi.ngwhois.ngNigeriaianawiki11pp..ng
preconjecturedefpreconjectu.rewhois.reReunion Islandianawiki13pp..re
preconjecturingdefpreconjecturi.ngwhois.ngNigeriaianawiki15pp..ng
preconnectivedefpreconnecti.vewhois.veVenezuelaianawiki13pp..ve
preconnubialdefpreconnubi.alwhois.alAlbaniaianawiki12pp..al
preconquerdefpreconqu.erwhois.erEritreaianawiki10pp..er
preconquestdefpreconque.stwhois.stSao Tome and Principeianawiki11pp..st
preconquestaldefpreconquest.alwhois.alAlbaniaianawiki13pp..al
preconquestualdefpreconquestu.alwhois.alAlbaniaianawiki14pp..al
preconsciousdefpreconscio.uswhois.usUnited Statesianawiki12pp..us
preconsciouslydefpreconscious.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
preconseccratingdefpreconseccrati.ngwhois.ngNigeriaianawiki16pp..ng
preconsecratingdefpreconsecrati.ngwhois.ngNigeriaianawiki15pp..ng
preconsiderdefpreconsid.erwhois.erEritreaianawiki11pp..er
preconsigndefpreconsi.gnwhois.gnGuineaianawiki10pp..gn
preconsolidatingdefpreconsolidati.ngwhois.ngNigeriaianawiki16pp..ng
preconsonantaldefpreconsonant.alwhois.alAlbaniaianawiki14pp..al
preconspiraciesdefpreconspiraci.eswhois.esSpainianawiki15pp..es
preconspiracydefpreconspira.cywhois.cyCyprusianawiki13pp..cy
preconspiredefpreconspi.rewhois.reReunion Islandianawiki11pp..re
preconspiringdefpreconspiri.ngwhois.ngNigeriaianawiki13pp..ng
preconstitutingdefpreconstituti.ngwhois.ngNigeriaianawiki15pp..ng
preconstructingdefpreconstructi.ngwhois.ngNigeriaianawiki15pp..ng
preconsultdefpreconsu.ltwhois.ltLithuaniaianawiki10pp..lt
preconsumerdefpreconsum.erwhois.erEritreaianawiki11pp..er
preconsumingdefpreconsumi.ngwhois.ngNigeriaianawiki12pp..ng
precontaindefpreconta.inwhois.inIndiaianawiki10pp..in
precontemndefpreconte.mnwhois.mnMongoliaianawiki10pp..mn
precontemplatingdefprecontemplati.ngwhois.ngNigeriaianawiki16pp..ng
precontemporaneousdefprecontemporaneo.uswhois.usUnited Statesianawiki18pp..us
precontemporaneouslydefprecontemporaneous.lywhois.lyLibyan Arab Jamahiriyaianawiki20pp..ly
precontentlydefprecontent.lywhois.lyLibyan Arab Jamahiriyaianawiki12pp..ly
precontestdefpreconte.stwhois.stSao Tome and Principeianawiki10pp..st
precontestdefprecon.testwhois.testPrivate TestingN/Awiki10pp..test
precontinentaldefprecontinent.alwhois.alAlbaniaianawiki14pp..al
precontractivedefprecontracti.vewhois.veVenezuelaianawiki14pp..ve
precontractualdefprecontractu.alwhois.alAlbaniaianawiki14pp..al
precontributingdefprecontributi.ngwhois.ngNigeriaianawiki15pp..ng
precontributivedefprecontributi.vewhois.veVenezuelaianawiki15pp..ve
precontrivedefprecontri.vewhois.veVenezuelaianawiki11pp..ve
precontrivesdefprecontriv.eswhois.esSpainianawiki12pp..es
precontrivingdefprecontrivi.ngwhois.ngNigeriaianawiki13pp..ng
precontrollingdefprecontrolli.ngwhois.ngNigeriaianawiki14pp..ng
precontroversialdefprecontroversi.alwhois.alAlbaniaianawiki16pp..al
precontroversiesdefprecontroversi.eswhois.esSpainianawiki16pp..es
precontroversydefprecontrover.sywhois.sySyrian Arab Republicianawiki14pp..sy
preconversationaldefpreconversation.alwhois.alAlbaniaianawiki17pp..al
preconveyaldefpreconvey.alwhois.alAlbaniaianawiki11pp..al
preconvincingdefpreconvinci.ngwhois.ngNigeriaianawiki13pp..ng
precookerdefprecook.erwhois.erEritreaianawiki9pp..er
precookingdefprecooki.ngwhois.ngNigeriaianawiki10pp..ng
precoolerdefprecool.erwhois.erEritreaianawiki9pp..er
precoolingdefprecooli.ngwhois.ngNigeriaianawiki10pp..ng
precoolsdefprecoo.lswhois.lsLesothoianawiki8pp..ls
precopernicandefprecopernic.anwhois.anNetherlands Antillesianawiki13pp..an
precopernicanismdefprecopernicani.smwhois.smSan Marinoianawiki16pp..sm
precopydefpreco.pywhois.pyParaguayianawiki7pp..py
precopyingdefprecopyi.ngwhois.ngNigeriaianawiki10pp..ng
precoracoiddefprecoraco.idwhois.idIndonesiaianawiki11pp..id
precordialdefprecordi.alwhois.alAlbaniaianawiki10pp..al
precordiallydefprecordial.lywhois.lyLibyan Arab Jamahiriyaianawiki12pp..ly
precordialpaindefprecordialpa.inwhois.inIndiaianawiki14pp..in
precordiumdefprecordi.umwhois.umUnited States Minor Outlying Islandsianawiki10pp..um
precornealdefprecorne.alwhois.alAlbaniaianawiki10pp..al
precornudefprecor.nuwhois.nuNiueianawiki8pp..nu
precorrectlydefprecorrect.lywhois.lyLibyan Arab Jamahiriyaianawiki12pp..ly
precorruptdefprecorru.ptwhois.ptPortugalianawiki10pp..pt
precorruptivedefprecorrupti.vewhois.veVenezuelaianawiki13pp..ve
precorruptlydefprecorrupt.lywhois.lyLibyan Arab Jamahiriyaianawiki12pp..ly
precosmicaldefprecosmic.alwhois.alAlbaniaianawiki11pp..al
precosmicallydefprecosmical.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
precostaldefprecost.alwhois.alAlbaniaianawiki9pp..al
precounselingdefprecounseli.ngwhois.ngNigeriaianawiki13pp..ng
precoursedefprecour.sewhois.seSwedenianawiki9pp..se
precoverdefprecov.erwhois.erEritreaianawiki8pp..er
precoveringdefprecoveri.ngwhois.ngNigeriaianawiki11pp..ng
precranialdefprecrani.alwhois.alAlbaniaianawiki10pp..al
precraniallydefprecranial.lywhois.lyLibyan Arab Jamahiriyaianawiki12pp..ly
precrashdefprecra.shwhois.shSaint Helenaianawiki8pp..sh
precreativedefprecreati.vewhois.veVenezuelaianawiki11pp..ve
precreditdefprecred.itwhois.itItalyianawiki9pp..it
precriticaldefprecritic.alwhois.alAlbaniaianawiki11pp..al
precriticismdefprecritici.smwhois.smSan Marinoianawiki12pp..sm
precriticizingdefprecriticizi.ngwhois.ngNigeriaianawiki14pp..ng
precrucialdefprecruci.alwhois.alAlbaniaianawiki10pp..al
precruraldefprecrur.alwhois.alAlbaniaianawiki9pp..al
precrusadedefprecrusa.dewhois.deGermanyianawiki10pp..de
precrystallinedefprecrystalli.newhois.neNigerianawiki14pp..ne
precultivatingdefprecultivati.ngwhois.ngNigeriaianawiki14pp..ng
preculturaldefprecultur.alwhois.alAlbaniaianawiki11pp..al
preculturallydefprecultural.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
preculturedefprecultu.rewhois.reReunion Islandianawiki10pp..re
precunealdefprecune.alwhois.alAlbaniaianawiki9pp..al
precuneusdefprecune.uswhois.usUnited Statesianawiki9pp..us
precuredefprecu.rewhois.reReunion Islandianawiki7pp..re
precuresdefprecur.eswhois.esSpainianawiki8pp..es
precuringdefprecuri.ngwhois.ngNigeriaianawiki9pp..ng
precurrerdefprecurr.erwhois.erEritreaianawiki9pp..er
precurriculadefprecurricu.lawhois.laLao People's Democratic Republicianawiki12pp..la
precurriculardefprecurricul.arwhois.arArgentinaianawiki13pp..ar
precurriculumdefprecurricul.umwhois.umUnited States Minor Outlying Islandsianawiki13pp..um
precurriculumsdefprecurriculu.mswhois.msMontserratianawiki14pp..ms
precursaldefprecurs.alwhois.alAlbaniaianawiki9pp..al
precursedefprecur.sewhois.seSwedenianawiki8pp..se
precursivedefprecursi.vewhois.veVenezuelaianawiki10pp..ve
precurtaindefprecurta.inwhois.inIndiaianawiki10pp..in
precyclonedefprecyclo.newhois.neNigerianawiki10pp..ne
precynicaldefprecynic.alwhois.alAlbaniaianawiki10pp..al
precystdefprecy.stwhois.stSao Tome and Principeianawiki7pp..st
predaceandefpredace.anwhois.anNetherlands Antillesianawiki9pp..an
predaceousdefpredaceo.uswhois.usUnited Statesianawiki10pp..us
predaciousdefpredacio.uswhois.usUnited Statesianawiki10pp..us
predamagedefpredama.gewhois.geGeorgiaianawiki9pp..ge
predamagingdefpredamagi.ngwhois.ngNigeriaianawiki11pp..ng
predamndefpreda.mnwhois.mnMongoliaianawiki7pp..mn
predanteandefpredante.anwhois.anNetherlands Antillesianawiki10pp..an
predarwiniandefpredarwini.anwhois.anNetherlands Antillesianawiki12pp..an
predarwinianismdefpredarwiniani.smwhois.smSan Marinoianawiki15pp..sm
predatesdefpredat.eswhois.esSpainianawiki8pp..es
predatingdefpredati.ngwhois.ngNigeriaianawiki9pp..ng
predationpressuredefpredationpressu.rewhois.reReunion Islandianawiki17pp..re
predatismdefpredati.smwhois.smSan Marinoianawiki9pp..sm
predativedefpredati.vewhois.veVenezuelaianawiki9pp..ve
predatorialdefpredatori.alwhois.alAlbaniaianawiki11pp..al
predatorilydefpredatori.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
predaylightdefpredaylig.htwhois.htHaitiianawiki11pp..ht
predealerdefpredeal.erwhois.erEritreaianawiki9pp..er
predealingdefpredeali.ngwhois.ngNigeriaianawiki10pp..ng
predeathdefpredea.thwhois.thThailandianawiki8pp..th
predeathlydefpredeath.lywhois.lyLibyan Arab Jamahiriyaianawiki10pp..ly
predebaterdefpredebat.erwhois.erEritreaianawiki10pp..er
predebitdefpredeb.itwhois.itItalyianawiki8pp..it
predeceasedefpredecea.sewhois.seSwedenianawiki10pp..se
predeceaserdefpredeceas.erwhois.erEritreaianawiki11pp..er
predeceasesdefpredeceas.eswhois.esSpainianawiki11pp..es
predeceasingdefpredeceasi.ngwhois.ngNigeriaianawiki12pp..ng
predeceivedefpredecei.vewhois.veVenezuelaianawiki10pp..ve
predeceiverdefpredeceiv.erwhois.erEritreaianawiki11pp..er
predeceivingdefpredeceivi.ngwhois.ngNigeriaianawiki12pp..ng
predecidedefpredeci.dewhois.deGermanyianawiki9pp..de
predecidingdefpredecidi.ngwhois.ngNigeriaianawiki11pp..ng
predecisivedefpredecisi.vewhois.veVenezuelaianawiki11pp..ve
predecisivelydefpredecisive.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
predeclaredefpredecla.rewhois.reReunion Islandianawiki10pp..re
predeclaringdefpredeclari.ngwhois.ngNigeriaianawiki12pp..ng
predeclinedefpredecli.newhois.neNigerianawiki10pp..ne
predecliningdefpredeclini.ngwhois.ngNigeriaianawiki12pp..ng
predecreedefpredecr.eewhois.eeEstoniaianawiki9pp..ee
predecreeingdefpredecreei.ngwhois.ngNigeriaianawiki12pp..ng
prededicatingdefprededicati.ngwhois.ngNigeriaianawiki13pp..ng
predefaultdefpredefau.ltwhois.ltLithuaniaianawiki10pp..lt
predefeatdefpredefe.atwhois.atAustriaianawiki9pp..at
predefectivedefpredefecti.vewhois.veVenezuelaianawiki12pp..ve
predefensedefpredefen.sewhois.seSwedenianawiki10pp..se
predeficiencydefpredeficien.cywhois.cyCyprusianawiki13pp..cy
predeficientlydefpredeficient.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
predefinedefpredefi.newhois.neNigerianawiki9pp..ne
predefinesdefpredefin.eswhois.esSpainianawiki10pp..es
predefiningdefpredefini.ngwhois.ngNigeriaianawiki11pp..ng
predefrayaldefpredefray.alwhois.alAlbaniaianawiki11pp..al
predefyingdefpredefyi.ngwhois.ngNigeriaianawiki10pp..ng
predegeneracydefpredegenera.cywhois.cyCyprusianawiki13pp..cy
predegreedefpredegr.eewhois.eeEstoniaianawiki9pp..ee
predelegatingdefpredelegati.ngwhois.ngNigeriaianawiki13pp..ng
predeliberatelydefpredeliberate.lywhois.lyLibyan Arab Jamahiriyaianawiki15pp..ly
predeliberatingdefpredeliberati.ngwhois.ngNigeriaianawiki15pp..ng
predelineatingdefpredelineati.ngwhois.ngNigeriaianawiki14pp..ng
predelinquencydefpredelinquen.cywhois.cyCyprusianawiki14pp..cy
predelinquentlydefpredelinquent.lywhois.lyLibyan Arab Jamahiriyaianawiki15pp..ly
predeliverdefpredeliv.erwhois.erEritreaianawiki10pp..er
predeliveriesdefpredeliveri.eswhois.esSpainianawiki13pp..es
predelladefpredel.lawhois.laLao People's Democratic Republicianawiki8pp..la
predeludedefpredelu.dewhois.deGermanyianawiki9pp..de
predeludingdefpredeludi.ngwhois.ngNigeriaianawiki11pp..ng
predemocracydefpredemocra.cywhois.cyCyprusianawiki12pp..cy
predemonstratingdefpredemonstrati.ngwhois.ngNigeriaianawiki16pp..ng
predemonstrativedefpredemonstrati.vewhois.veVenezuelaianawiki16pp..ve
predenialdefpredeni.alwhois.alAlbaniaianawiki9pp..al
predentaldefpredent.alwhois.alAlbaniaianawiki9pp..al
predenyingdefpredenyi.ngwhois.ngNigeriaianawiki10pp..ng
predepartmentaldefpredepartment.alwhois.alAlbaniaianawiki15pp..al
predeparturedefpredepartu.rewhois.reReunion Islandianawiki12pp..re
predepletingdefpredepleti.ngwhois.ngNigeriaianawiki12pp..ng
predepositdefpredepos.itwhois.itItalyianawiki10pp..it
predepreciatingdefpredepreciati.ngwhois.ngNigeriaianawiki15pp..ng
predeprivedefpredepri.vewhois.veVenezuelaianawiki10pp..ve
predeprivingdefpredeprivi.ngwhois.ngNigeriaianawiki12pp..ng
prederivedefprederi.vewhois.veVenezuelaianawiki9pp..ve
prederivingdefprederivi.ngwhois.ngNigeriaianawiki11pp..ng
predescribedefpredescri.bewhois.beBelgiumianawiki11pp..be
predescribingdefpredescribi.ngwhois.ngNigeriaianawiki13pp..ng
predeserterdefpredesert.erwhois.erEritreaianawiki11pp..er
predeservedefpredeser.vewhois.veVenezuelaianawiki10pp..ve
predeservingdefpredeservi.ngwhois.ngNigeriaianawiki12pp..ng
predesigndefpredesi.gnwhois.gnGuineaianawiki9pp..gn
predesignatesdefpredesignat.eswhois.esSpainianawiki13pp..es
predesignatingdefpredesignati.ngwhois.ngNigeriaianawiki14pp..ng
predesirousdefpredesiro.uswhois.usUnited Statesianawiki11pp..us
predesirouslydefpredesirous.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
predespairdefpredespa.irwhois.irIran, Islamic Republic ofianawiki10pp..ir
predespisedefpredespi.sewhois.seSwedenianawiki10pp..se
predespondencydefpredesponden.cywhois.cyCyprusianawiki14pp..cy
predestinariandefpredestinari.anwhois.anNetherlands Antillesianawiki14pp..an
predestinarianismdefpredestinariani.smwhois.smSan Marinoianawiki17pp..sm
predestinatelydefpredestinate.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
predestinatesdefpredestinat.eswhois.esSpainianawiki13pp..es
predestinatingdefpredestinati.ngwhois.ngNigeriaianawiki14pp..ng
predestinationaldefpredestination.alwhois.alAlbaniaianawiki16pp..al
predestinationismdefpredestinationi.smwhois.smSan Marinoianawiki17pp..sm
predestinationistdefpredestinationi.stwhois.stSao Tome and Principeianawiki17pp..st
predestinativedefpredestinati.vewhois.veVenezuelaianawiki14pp..ve
predestinedefpredesti.newhois.neNigerianawiki10pp..ne
predestinesdefpredestin.eswhois.esSpainianawiki11pp..es
predestiningdefpredestini.ngwhois.ngNigeriaianawiki12pp..ng
predetachdefpredeta.chwhois.chSwitzerlandianawiki9pp..ch
predetaildefpredeta.ilwhois.ilIsraelianawiki9pp..il
predetaindefpredeta.inwhois.inIndiaianawiki9pp..in
predetainerdefpredetain.erwhois.erEritreaianawiki11pp..er
predeterminatelydefpredeterminate.lywhois.lyLibyan Arab Jamahiriyaianawiki16pp..ly
predeterminativedefpredeterminati.vewhois.veVenezuelaianawiki16pp..ve
predeterminedefpredetermi.newhois.neNigerianawiki12pp..ne
predeterminerdefpredetermin.erwhois.erEritreaianawiki13pp..er
predeterminesdefpredetermin.eswhois.esSpainianawiki13pp..es
predeterminingdefpredetermini.ngwhois.ngNigeriaianawiki14pp..ng
predeterminismdefpredetermini.smwhois.smSan Marinoianawiki14pp..sm
predetestdefpredete.stwhois.stSao Tome and Principeianawiki9pp..st
predetestdefprede.testwhois.testPrivate TestingN/Awiki9pp..test
predetrimentaldefpredetriment.alwhois.alAlbaniaianawiki14pp..al
predevisedefpredevi.sewhois.seSwedenianawiki9pp..se
predevisingdefpredevisi.ngwhois.ngNigeriaianawiki11pp..ng
prediabetesdefprediabet.eswhois.esSpainianawiki11pp..es
prediagnosesdefprediagnos.eswhois.esSpainianawiki12pp..es
prediagnosisdefprediagnos.iswhois.isIcelandianawiki12pp..is
predialdefpredi.alwhois.alAlbaniaianawiki7pp..al
predialistdefprediali.stwhois.stSao Tome and Principeianawiki10pp..st
predicablydefpredicab.lywhois.lyLibyan Arab Jamahiriyaianawiki10pp..ly
predicamentaldefpredicament.alwhois.alAlbaniaianawiki13pp..al
predicamentallydefpredicamental.lywhois.lyLibyan Arab Jamahiriyaianawiki15pp..ly
predicateadjectivedefpredicateadjecti.vewhois.veVenezuelaianawiki18pp..ve
predicatecalculusdefpredicatecalcul.uswhois.usUnited Statesianawiki17pp..us
predicatenominativedefpredicatenominati.vewhois.veVenezuelaianawiki19pp..ve
predicateobjectivedefpredicateobjecti.vewhois.veVenezuelaianawiki18pp..ve
predicatesdefpredicat.eswhois.esSpainianawiki10pp..es
predicatingdefpredicati.ngwhois.ngNigeriaianawiki11pp..ng
predicationaldefpredication.alwhois.alAlbaniaianawiki13pp..al
predicativedefpredicati.vewhois.veVenezuelaianawiki11pp..ve
predicativelydefpredicative.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
predickensiandefpredickensi.anwhois.anNetherlands Antillesianawiki13pp..an
predictableresponsedefpredictablerespon.sewhois.seSwedenianawiki19pp..se
predictablydefpredictab.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
predictatingdefpredictati.ngwhois.ngNigeriaianawiki12pp..ng
predictingdefpredicti.ngwhois.ngNigeriaianawiki10pp..ng
predictionaldefprediction.alwhois.alAlbaniaianawiki12pp..al
predictivedefpredicti.vewhois.veVenezuelaianawiki10pp..ve
predictivelydefpredictive.lywhois.lyLibyan Arab Jamahiriyaianawiki12pp..ly
predietdefpredi.etwhois.etEthiopiaianawiki7pp..et
predigestdefpredige.stwhois.stSao Tome and Principeianawiki9pp..st
predigestingdefpredigesti.ngwhois.ngNigeriaianawiki12pp..ng
predigitaldefpredigit.alwhois.alAlbaniaianawiki10pp..al
prediligentlydefprediligent.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
prediluvialdefprediluvi.alwhois.alAlbaniaianawiki11pp..al
prediluviandefprediluvi.anwhois.anNetherlands Antillesianawiki11pp..an
prediminishdefpredimini.shwhois.shSaint Helenaianawiki11pp..sh
predinedefpredi.newhois.neNigerianawiki7pp..ne
prediningdefpredini.ngwhois.ngNigeriaianawiki9pp..ng
predinnerdefpredinn.erwhois.erEritreaianawiki9pp..er
prediplomadefprediplo.mawhois.maMoroccoianawiki10pp..ma
prediplomacydefprediploma.cywhois.cyCyprusianawiki12pp..cy
predisadvantagedefpredisadvanta.gewhois.geGeorgiaianawiki15pp..ge
predisadvantageousdefpredisadvantageo.uswhois.usUnited Statesianawiki18pp..us
predisadvantageouslydefpredisadvantageous.lywhois.lyLibyan Arab Jamahiriyaianawiki20pp..ly
predisagreedefpredisagr.eewhois.eeEstoniaianawiki11pp..ee
predisagreeingdefpredisagreei.ngwhois.ngNigeriaianawiki14pp..ng
predisasterdefpredisast.erwhois.erEritreaianawiki11pp..er
predisastrousdefpredisastro.uswhois.usUnited Statesianawiki13pp..us
predisastrouslydefpredisastrous.lywhois.lyLibyan Arab Jamahiriyaianawiki15pp..ly
predischargedefpredischar.gewhois.geGeorgiaianawiki12pp..ge
predischargingdefpredischargi.ngwhois.ngNigeriaianawiki14pp..ng
predisciplinedefprediscipli.newhois.neNigerianawiki13pp..ne
prediscipliningdefpredisciplini.ngwhois.ngNigeriaianawiki15pp..ng
predisclosedefpredisclo.sewhois.seSwedenianawiki11pp..se
predisclosingdefpredisclosi.ngwhois.ngNigeriaianawiki13pp..ng
predisclosuredefpredisclosu.rewhois.reReunion Islandianawiki13pp..re
prediscouragedefprediscoura.gewhois.geGeorgiaianawiki13pp..ge
prediscouragingdefprediscouragi.ngwhois.ngNigeriaianawiki15pp..ng
prediscoursedefprediscour.sewhois.seSwedenianawiki12pp..se
prediscoverdefprediscov.erwhois.erEritreaianawiki11pp..er
prediscovererdefprediscover.erwhois.erEritreaianawiki13pp..er
prediscoveriesdefprediscoveri.eswhois.esSpainianawiki14pp..es
prediscreetdefprediscre.etwhois.etEthiopiaianawiki11pp..et
prediscriminatingdefprediscriminati.ngwhois.ngNigeriaianawiki17pp..ng
predisguisedefpredisgui.sewhois.seSwedenianawiki11pp..se
predisguisingdefpredisguisi.ngwhois.ngNigeriaianawiki13pp..ng
predisgustdefpredisgu.stwhois.stSao Tome and Principeianawiki10pp..st
predislikedefpredisli.kewhois.keKenyaianawiki10pp..ke
predislikingdefpredisliki.ngwhois.ngNigeriaianawiki12pp..ng
predismissaldefpredismiss.alwhois.alAlbaniaianawiki12pp..al
predisorderdefpredisord.erwhois.erEritreaianawiki11pp..er
predisorderlydefpredisorder.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
predispatchdefpredispat.chwhois.chSwitzerlandianawiki11pp..ch
predispatcherdefpredispatch.erwhois.erEritreaianawiki13pp..er
predispersedefpredisper.sewhois.seSwedenianawiki11pp..se
predispersingdefpredispersi.ngwhois.ngNigeriaianawiki13pp..ng
predisplacingdefpredisplaci.ngwhois.ngNigeriaianawiki13pp..ng
predisponencydefpredisponen.cywhois.cyCyprusianawiki13pp..cy
predisposaldefpredispos.alwhois.alAlbaniaianawiki11pp..al
predisposedefpredispo.sewhois.seSwedenianawiki10pp..se
predisposedlydefpredisposed.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
predisposedtodefpredisposed.towhois.toTongaianawiki13pp..to
predisposesdefpredispos.eswhois.esSpainianawiki11pp..es
predisposingdefpredisposi.ngwhois.ngNigeriaianawiki12pp..ng
predispositionaldefpredisposition.alwhois.alAlbaniaianawiki16pp..al
predisputingdefpredisputi.ngwhois.ngNigeriaianawiki12pp..ng
predisruptdefpredisru.ptwhois.ptPortugalianawiki10pp..pt
predissolvedefpredissol.vewhois.veVenezuelaianawiki11pp..ve
predissolvingdefpredissolvi.ngwhois.ngNigeriaianawiki13pp..ng
predissuadedefpredissua.dewhois.deGermanyianawiki11pp..de
predissuadingdefpredissuadi.ngwhois.ngNigeriaianawiki13pp..ng
predistinguishdefpredistingui.shwhois.shSaint Helenaianawiki14pp..sh
predistributingdefpredistributi.ngwhois.ngNigeriaianawiki15pp..ng
predistrustdefpredistru.stwhois.stSao Tome and Principeianawiki11pp..st
predivedefpredi.vewhois.veVenezuelaianawiki7pp..ve
predividedefpredivi.dewhois.deGermanyianawiki9pp..de
predividerdefpredivid.erwhois.erEritreaianawiki10pp..er
predividingdefpredividi.ngwhois.ngNigeriaianawiki11pp..ng
prednisolonedefprednisolo.newhois.neNigerianawiki12pp..ne
prednisonedefpredniso.newhois.neNigerianawiki10pp..ne
prednisonesdefprednison.eswhois.esSpainianawiki11pp..es
predoctoraldefpredoctor.alwhois.alAlbaniaianawiki11pp..al
predomesticallydefpredomestical.lywhois.lyLibyan Arab Jamahiriyaianawiki15pp..ly
predominanceofaquariusdefpredominanceofaquari.uswhois.usUnited Statesianawiki22pp..us
predominancesdefpredominanc.eswhois.esSpainianawiki13pp..es
predominancydefpredominan.cywhois.cyCyprusianawiki12pp..cy
predominantlydefpredominant.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
predominatelydefpredominate.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
predominatesdefpredominat.eswhois.esSpainianawiki12pp..es
predominatingdefpredominati.ngwhois.ngNigeriaianawiki13pp..ng
predominatinglydefpredominating.lywhois.lyLibyan Arab Jamahiriyaianawiki15pp..ly
predonatingdefpredonati.ngwhois.ngNigeriaianawiki11pp..ng
predoomdefpredo.omwhois.omOmanianawiki7pp..om
predoriandefpredori.anwhois.anNetherlands Antillesianawiki9pp..an
predorsaldefpredors.alwhois.alAlbaniaianawiki9pp..al
predoubtdefpredou.btwhois.btBhutanianawiki8pp..bt
predoubterdefpredoubt.erwhois.erEritreaianawiki10pp..er
predoubtfullydefpredoubtful.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
predrainagedefpredraina.gewhois.geGeorgiaianawiki11pp..ge
predravidiandefpredravidi.anwhois.anNetherlands Antillesianawiki12pp..an
predrawdefpredr.awwhois.awArubaianawiki7pp..aw
predrawerdefpredraw.erwhois.erEritreaianawiki9pp..er
predrawingdefpredrawi.ngwhois.ngNigeriaianawiki10pp..ng
predreaddefpredre.adwhois.adAndorraianawiki8pp..ad
predreadnoughtdefpredreadnoug.htwhois.htHaitiianawiki14pp..ht
predrillerdefpredrill.erwhois.erEritreaianawiki10pp..er
predrivedefpredri.vewhois.veVenezuelaianawiki8pp..ve
predriverdefpredriv.erwhois.erEritreaianawiki9pp..er
predrivingdefpredrivi.ngwhois.ngNigeriaianawiki10pp..ng
predrovedefpredro.vewhois.veVenezuelaianawiki8pp..ve
predryingdefpredryi.ngwhois.ngNigeriaianawiki9pp..ng
preduplicatingdefpreduplicati.ngwhois.ngNigeriaianawiki14pp..ng
preduskdefpredu.skwhois.skSlovak Republicianawiki7pp..sk
predutchdefpredut.chwhois.chSwitzerlandianawiki8pp..ch
preedefpr.eewhois.eeEstoniaianawiki4pp..ee
preearthlydefpreearth.lywhois.lyLibyan Arab Jamahiriyaianawiki10pp..ly
preearthquakedefpreearthqua.kewhois.keKenyaianawiki13pp..ke
preeasterdefpreeast.erwhois.erEritreaianawiki9pp..er
preeconomicaldefpreeconomic.alwhois.alAlbaniaianawiki13pp..al
preeconomicallydefpreeconomical.lywhois.lyLibyan Arab Jamahiriyaianawiki15pp..ly
preeditdefpreed.itwhois.itItalyianawiki7pp..it
preeditorialdefpreeditori.alwhois.alAlbaniaianawiki12pp..al
preeditoriallydefpreeditorial.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
preeducatingdefpreeducati.ngwhois.ngNigeriaianawiki12pp..ng
preeducationaldefpreeducation.alwhois.alAlbaniaianawiki14pp..al
preeducationallydefpreeducational.lywhois.lyLibyan Arab Jamahiriyaianawiki16pp..ly
preeffectivedefpreeffecti.vewhois.veVenezuelaianawiki12pp..ve
preeffectivelydefpreeffective.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
preeffectualdefpreeffectu.alwhois.alAlbaniaianawiki12pp..al
preeffectuallydefpreeffectual.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
preefficiencydefpreefficien.cywhois.cyCyprusianawiki13pp..cy
preefficientlydefpreefficient.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
preeingdefpreei.ngwhois.ngNigeriaianawiki7pp..ng
preelectingdefpreelecti.ngwhois.ngNigeriaianawiki11pp..ng
preelectivedefpreelecti.vewhois.veVenezuelaianawiki11pp..ve
preelectricaldefpreelectric.alwhois.alAlbaniaianawiki13pp..al
preelectricallydefpreelectrical.lywhois.lyLibyan Arab Jamahiriyaianawiki15pp..ly
preelementaldefpreelement.alwhois.alAlbaniaianawiki12pp..al
preeligiblydefpreeligib.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
preeliminatingdefpreeliminati.ngwhois.ngNigeriaianawiki14pp..ng
preelizabethandefpreelizabeth.anwhois.anNetherlands Antillesianawiki14pp..an
preembodyingdefpreembodyi.ngwhois.ngNigeriaianawiki12pp..ng
preemergenciesdefpreemergenci.eswhois.esSpainianawiki14pp..es
preemergencydefpreemergen.cywhois.cyCyprusianawiki12pp..cy
preemiedefpreem.iewhois.ieIrelandianawiki7pp..ie
preemiesdefpreemi.eswhois.esSpainianawiki8pp..es
preeminencesdefpreeminenc.eswhois.esSpainianawiki12pp..es
preeminencydefpreeminen.cywhois.cyCyprusianawiki11pp..cy
preeminentlydefpreeminent.lywhois.lyLibyan Arab Jamahiriyaianawiki12pp..ly
preemotionaldefpreemotion.alwhois.alAlbaniaianawiki12pp..al
preemotionallydefpreemotional.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
preemphasisdefpreemphas.iswhois.isIcelandianawiki11pp..is
preempiredefpreempi.rewhois.reReunion Islandianawiki9pp..re
preemployeedefpreemploy.eewhois.eeEstoniaianawiki11pp..ee
preemployerdefpreemploy.erwhois.erEritreaianawiki11pp..er
preemptdefpreem.ptwhois.ptPortugalianawiki7pp..pt
preemptingdefpreempti.ngwhois.ngNigeriaianawiki10pp..ng
preemptionerdefpreemption.erwhois.erEritreaianawiki12pp..er
preemptionrightdefpreemptionrig.htwhois.htHaitiianawiki15pp..ht
preemptivedefpreempti.vewhois.veVenezuelaianawiki10pp..ve
preemptivelydefpreemptive.lywhois.lyLibyan Arab Jamahiriyaianawiki12pp..ly
preenablingdefpreenabli.ngwhois.ngNigeriaianawiki11pp..ng
preenactingdefpreenacti.ngwhois.ngNigeriaianawiki11pp..ng
preenclosedefpreenclo.sewhois.seSwedenianawiki10pp..se
preenclosingdefpreenclosi.ngwhois.ngNigeriaianawiki12pp..ng
preenclosuredefpreenclosu.rewhois.reReunion Islandianawiki12pp..re
preencounterdefpreencount.erwhois.erEritreaianawiki12pp..er
preencouragedefpreencoura.gewhois.geGeorgiaianawiki12pp..ge
preendorsedefpreendor.sewhois.seSwedenianawiki10pp..se
preendorserdefpreendors.erwhois.erEritreaianawiki11pp..er
preendorsingdefpreendorsi.ngwhois.ngNigeriaianawiki12pp..ng
preenerdefpreen.erwhois.erEritreaianawiki7pp..er
preenergydefpreener.gywhois.gyGuyanaianawiki9pp..gy
preenforcingdefpreenforci.ngwhois.ngNigeriaianawiki12pp..ng
preengagedefpreenga.gewhois.geGeorgiaianawiki9pp..ge
preengagesdefpreengag.eswhois.esSpainianawiki10pp..es
preengagingdefpreengagi.ngwhois.ngNigeriaianawiki11pp..ng
preengineeringdefpreengineeri.ngwhois.ngNigeriaianawiki14pp..ng
preenglishdefpreengli.shwhois.shSaint Helenaianawiki10pp..sh
preeningdefpreeni.ngwhois.ngNigeriaianawiki8pp..ng
preenlargedefpreenlar.gewhois.geGeorgiaianawiki10pp..ge
preenlargingdefpreenlargi.ngwhois.ngNigeriaianawiki12pp..ng
preenlightenerdefpreenlighten.erwhois.erEritreaianawiki14pp..er
preenlighteningdefpreenlighteni.ngwhois.ngNigeriaianawiki15pp..ng
preenlistdefpreenli.stwhois.stSao Tome and Principeianawiki9pp..st
preentaildefpreenta.ilwhois.ilIsraelianawiki9pp..il
preenterdefpreent.erwhois.erEritreaianawiki8pp..er
preentertaindefpreenterta.inwhois.inIndiaianawiki12pp..in
preentertainerdefpreentertain.erwhois.erEritreaianawiki14pp..er
preenthusiasmdefpreenthusia.smwhois.smSan Marinoianawiki13pp..sm
preentitlingdefpreentitli.ngwhois.ngNigeriaianawiki12pp..ng
preenumeratingdefpreenumerati.ngwhois.ngNigeriaianawiki14pp..ng
preenvironmentaldefpreenvironment.alwhois.alAlbaniaianawiki16pp..al
preepochaldefpreepoch.alwhois.alAlbaniaianawiki10pp..al
preequippingdefpreequippi.ngwhois.ngNigeriaianawiki12pp..ng
preeruptdefpreeru.ptwhois.ptPortugalianawiki8pp..pt
preeruptivedefpreerupti.vewhois.veVenezuelaianawiki11pp..ve
preeruptivelydefpreeruptive.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
preesdefpre.eswhois.esSpainianawiki5pp..es
preescapedefpreesca.pewhois.pePeruianawiki9pp..pe
preescapingdefpreescapi.ngwhois.ngNigeriaianawiki11pp..ng
preesophagealdefpreesophage.alwhois.alAlbaniaianawiki13pp..al
preessentialdefpreessenti.alwhois.alAlbaniaianawiki12pp..al
preessentiallydefpreessential.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
preestablishdefpreestabli.shwhois.shSaint Helenaianawiki12pp..sh
preestablisherdefpreestablish.erwhois.erEritreaianawiki14pp..er
preestablishesdefpreestablish.eswhois.esSpainianawiki14pp..es
preestablishingdefpreestablishi.ngwhois.ngNigeriaianawiki15pp..ng
preestimatesdefpreestimat.eswhois.esSpainianawiki12pp..es
preestimatingdefpreestimati.ngwhois.ngNigeriaianawiki13pp..ng
preestivaldefpreestiv.alwhois.alAlbaniaianawiki10pp..al
preeterdefpreet.erwhois.erEritreaianawiki7pp..er
preeternaldefpreetern.alwhois.alAlbaniaianawiki10pp..al
preevadedefpreeva.dewhois.deGermanyianawiki8pp..de
preevadingdefpreevadi.ngwhois.ngNigeriaianawiki10pp..ng
preevaporatingdefpreevaporati.ngwhois.ngNigeriaianawiki14pp..ng
preevidentlydefpreevident.lywhois.lyLibyan Arab Jamahiriyaianawiki12pp..ly
preevolutionaldefpreevolution.alwhois.alAlbaniaianawiki14pp..al
preevolutionistdefpreevolutioni.stwhois.stSao Tome and Principeianawiki15pp..st
preexaminedefpreexami.newhois.neNigerianawiki10pp..ne
preexaminerdefpreexamin.erwhois.erEritreaianawiki11pp..er
preexaminesdefpreexamin.eswhois.esSpainianawiki11pp..es
preexaminingdefpreexamini.ngwhois.ngNigeriaianawiki12pp..ng
preexcellencydefpreexcellen.cywhois.cyCyprusianawiki13pp..cy
preexceptdefpreexce.ptwhois.ptPortugalianawiki9pp..pt
preexceptionaldefpreexception.alwhois.alAlbaniaianawiki14pp..al
preexceptionallydefpreexceptional.lywhois.lyLibyan Arab Jamahiriyaianawiki16pp..ly
preexchangedefpreexchan.gewhois.geGeorgiaianawiki11pp..ge
preexchangingdefpreexchangi.ngwhois.ngNigeriaianawiki13pp..ng
preexcitingdefpreexciti.ngwhois.ngNigeriaianawiki11pp..ng
preexcludedefpreexclu.dewhois.deGermanyianawiki10pp..de
preexcludingdefpreexcludi.ngwhois.ngNigeriaianawiki12pp..ng
preexclusivedefpreexclusi.vewhois.veVenezuelaianawiki12pp..ve
preexclusivelydefpreexclusive.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
preexcusedefpreexcu.sewhois.seSwedenianawiki9pp..se
preexcusingdefpreexcusi.ngwhois.ngNigeriaianawiki11pp..ng
preexecutingdefpreexecuti.ngwhois.ngNigeriaianawiki12pp..ng
preexemptdefpreexem.ptwhois.ptPortugalianawiki9pp..pt
preexhaustdefpreexhau.stwhois.stSao Tome and Principeianawiki10pp..st
preexhibitdefpreexhib.itwhois.itItalyianawiki10pp..it
preexiliandefpreexili.anwhois.anNetherlands Antillesianawiki10pp..an
preexistdefpreexi.stwhois.stSao Tome and Principeianawiki8pp..st
preexistencesdefpreexistenc.eswhois.esSpainianawiki13pp..es
preexistentismdefpreexistenti.smwhois.smSan Marinoianawiki14pp..sm
preexistingdefpreexisti.ngwhois.ngNigeriaianawiki11pp..ng
preexpendituredefpreexpenditu.rewhois.reReunion Islandianawiki14pp..re
preexpensedefpreexpen.sewhois.seSwedenianawiki10pp..se
preexperiencingdefpreexperienci.ngwhois.ngNigeriaianawiki15pp..ng
preexperimentaldefpreexperiment.alwhois.alAlbaniaianawiki15pp..al
preexplaindefpreexpla.inwhois.inIndiaianawiki10pp..in
preexplodedefpreexplo.dewhois.deGermanyianawiki10pp..de
preexplodingdefpreexplodi.ngwhois.ngNigeriaianawiki12pp..ng
preexposedefpreexpo.sewhois.seSwedenianawiki9pp..se
preexposesdefpreexpos.eswhois.esSpainianawiki10pp..es
preexposingdefpreexposi.ngwhois.ngNigeriaianawiki11pp..ng
preexposuredefpreexposu.rewhois.reReunion Islandianawiki11pp..re
preexposuresdefpreexposur.eswhois.esSpainianawiki12pp..es
preexpounderdefpreexpound.erwhois.erEritreaianawiki12pp..er
preexpressivedefpreexpressi.vewhois.veVenezuelaianawiki13pp..ve
preextensivedefpreextensi.vewhois.veVenezuelaianawiki12pp..ve
preextensivelydefpreextensive.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
preextinguishdefpreextingui.shwhois.shSaint Helenaianawiki13pp..sh
prefabbingdefprefabbi.ngwhois.ngNigeriaianawiki10pp..ng
prefabricatedhousedefprefabricatedhou.sewhois.seSwedenianawiki18pp..se
prefabricatesdefprefabricat.eswhois.esSpainianawiki13pp..es
prefabricatingdefprefabricati.ngwhois.ngNigeriaianawiki14pp..ng
prefabsdefprefa.bswhois.bsBahamasianawiki7pp..bs
prefabulousdefprefabulo.uswhois.usUnited Statesianawiki11pp..us
prefacerdefprefac.erwhois.erEritreaianawiki8pp..er
prefacesdefprefac.eswhois.esSpainianawiki8pp..es
prefacialdefprefaci.alwhois.alAlbaniaianawiki9pp..al
prefacingdefprefaci.ngwhois.ngNigeriaianawiki9pp..ng
prefacistdefprefaci.stwhois.stSao Tome and Principeianawiki9pp..st
prefadedefprefa.dewhois.deGermanyianawiki7pp..de
prefadesdefprefad.eswhois.esSpainianawiki8pp..es
prefamiliardefprefamili.arwhois.arArgentinaianawiki11pp..ar
prefamiliarlydefprefamiliar.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
prefamousdefprefamo.uswhois.usUnited Statesianawiki9pp..us
prefamouslydefprefamous.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
prefatialdefprefati.alwhois.alAlbaniaianawiki9pp..al
prefatorialdefprefatori.alwhois.alAlbaniaianawiki11pp..al
prefatoriallydefprefatorial.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
prefatorilydefprefatori.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
prefavorablydefprefavorab.lywhois.lyLibyan Arab Jamahiriyaianawiki12pp..ly
prefearfullydefprefearful.lywhois.lyLibyan Arab Jamahiriyaianawiki12pp..ly
prefeastdefprefea.stwhois.stSao Tome and Principeianawiki8pp..st
prefectlydefprefect.lywhois.lyLibyan Arab Jamahiriyaianawiki9pp..ly
prefectoraldefprefector.alwhois.alAlbaniaianawiki11pp..al
prefectorialdefprefectori.alwhois.alAlbaniaianawiki12pp..al
prefectoriallydefprefectorial.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
prefectoriandefprefectori.anwhois.anNetherlands Antillesianawiki12pp..an
prefectualdefprefectu.alwhois.alAlbaniaianawiki10pp..al
prefecturaldefprefectur.alwhois.alAlbaniaianawiki11pp..al
prefecturedefprefectu.rewhois.reReunion Islandianawiki10pp..re
prefecturesdefprefectur.eswhois.esSpainianawiki11pp..es
prefederaldefprefeder.alwhois.alAlbaniaianawiki10pp..al
preferdefpref.erwhois.erEritreaianawiki6pp..er
preferablydefpreferab.lywhois.lyLibyan Arab Jamahiriyaianawiki10pp..ly
preferaclaimdefpreferacla.imwhois.imIsle of Manianawiki12pp..im
preferchargesdefprefercharg.eswhois.esSpainianawiki13pp..es
prefereedefprefer.eewhois.eeEstoniaianawiki8pp..ee
preferenceforthebestdefpreferenceforthebe.stwhois.stSao Tome and Principeianawiki20pp..st
preferencesdefpreferenc.eswhois.esSpainianawiki11pp..es
preferencesharedefpreferencesha.rewhois.reReunion Islandianawiki15pp..re
preferencesharesdefpreferenceshar.eswhois.esSpainianawiki16pp..es
preferencestockdefpreferencesto.ckwhois.ckCook Islandsianawiki15pp..ck
preferentialdefpreferenti.alwhois.alAlbaniaianawiki12pp..al
preferentialismdefpreferentiali.smwhois.smSan Marinoianawiki15pp..sm
preferentialistdefpreferentiali.stwhois.stSao Tome and Principeianawiki15pp..st
preferentiallydefpreferential.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
preferentialvotingdefpreferentialvoti.ngwhois.ngNigeriaianawiki18pp..ng
preferncefreightdefpreferncefreig.htwhois.htHaitiianawiki16pp..ht
preferraldefpreferr.alwhois.alAlbaniaianawiki9pp..al
preferredliedefpreferredl.iewhois.ieIrelandianawiki12pp..ie
preferredlydefpreferred.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
preferredstockdefpreferredsto.ckwhois.ckCook Islandsianawiki14pp..ck
preferrerdefpreferr.erwhois.erEritreaianawiki9pp..er
preferringdefpreferri.ngwhois.ngNigeriaianawiki10pp..ng
preferrousdefpreferro.uswhois.usUnited Statesianawiki10pp..us
prefertilizingdefprefertilizi.ngwhois.ngNigeriaianawiki14pp..ng
prefertodefprefer.towhois.toTongaianawiki8pp..to
preferviddefpreferv.idwhois.idIndonesiaianawiki9pp..id
prefestivaldefprefestiv.alwhois.alAlbaniaianawiki11pp..al
prefetdefpref.etwhois.etEthiopiaianawiki6pp..et
prefeudaldefprefeud.alwhois.alAlbaniaianawiki9pp..al
prefeudalismdefprefeudali.smwhois.smSan Marinoianawiki12pp..sm
prefictionaldefprefiction.alwhois.alAlbaniaianawiki12pp..al
prefightdefprefig.htwhois.htHaitiianawiki8pp..ht
prefigurativedefprefigurati.vewhois.veVenezuelaianawiki13pp..ve
prefigurativelydefprefigurative.lywhois.lyLibyan Arab Jamahiriyaianawiki15pp..ly
prefiguredefprefigu.rewhois.reReunion Islandianawiki9pp..re
prefigurerdefprefigur.erwhois.erEritreaianawiki10pp..er
prefiguresdefprefigur.eswhois.esSpainianawiki10pp..es
prefiguringdefprefiguri.ngwhois.ngNigeriaianawiki11pp..ng
prefilesdefprefil.eswhois.esSpainianawiki8pp..es
prefillerdefprefill.erwhois.erEritreaianawiki9pp..er
prefillsdefprefil.lswhois.lsLesothoianawiki8pp..ls
prefilterdefprefilt.erwhois.erEritreaianawiki9pp..er
prefinaldefprefin.alwhois.alAlbaniaianawiki8pp..al
prefinancialdefprefinanci.alwhois.alAlbaniaianawiki12pp..al
prefinancingdefprefinanci.ngwhois.ngNigeriaianawiki12pp..ng
prefinedefprefi.newhois.neNigerianawiki7pp..ne
prefinishdefprefini.shwhois.shSaint Helenaianawiki9pp..sh
prefiredefprefi.rewhois.reReunion Islandianawiki7pp..re
prefiresdefprefir.eswhois.esSpainianawiki8pp..es
prefixaldefprefix.alwhois.alAlbaniaianawiki8pp..al
prefixallydefprefixal.lywhois.lyLibyan Arab Jamahiriyaianawiki10pp..ly
prefixedlydefprefixed.lywhois.lyLibyan Arab Jamahiriyaianawiki10pp..ly
prefixesdefprefix.eswhois.esSpainianawiki8pp..es
prefixingdefprefixi.ngwhois.ngNigeriaianawiki9pp..ng
prefixturedefprefixtu.rewhois.reReunion Islandianawiki10pp..re
preflatterdefpreflatt.erwhois.erEritreaianawiki10pp..er
preflavoringdefpreflavori.ngwhois.ngNigeriaianawiki12pp..ng
preflightdefpreflig.htwhois.htHaitiianawiki9pp..ht
prefloweringdefprefloweri.ngwhois.ngNigeriaianawiki12pp..ng
prefocusdefprefoc.uswhois.usUnited Statesianawiki8pp..us
prefocusesdefprefocus.eswhois.esSpainianawiki10pp..es
prefocusingdefprefocusi.ngwhois.ngNigeriaianawiki11pp..ng
prefocussesdefprefocuss.eswhois.esSpainianawiki11pp..es
prefocussingdefprefocussi.ngwhois.ngNigeriaianawiki12pp..ng
preforcepsdefpreforce.pswhois.psPalestinian Territory (Occupied)ianawiki10pp..ps
preforgavedefpreforga.vewhois.veVenezuelaianawiki10pp..ve
preforgivedefpreforgi.vewhois.veVenezuelaianawiki10pp..ve
preforgivingdefpreforgivi.ngwhois.ngNigeriaianawiki12pp..ng
preformationismdefpreformationi.smwhois.smSan Marinoianawiki15pp..sm
preformationistdefpreformationi.stwhois.stSao Tome and Principeianawiki15pp..st
preformativedefpreformati.vewhois.veVenezuelaianawiki12pp..ve
preformingdefpreformi.ngwhois.ngNigeriaianawiki10pp..ng
preformismdefpreformi.smwhois.smSan Marinoianawiki10pp..sm
preformistdefpreformi.stwhois.stSao Tome and Principeianawiki10pp..st
preformsdefprefor.mswhois.msMontserratianawiki8pp..ms
preformulatingdefpreformulati.ngwhois.ngNigeriaianawiki14pp..ng
prefortunatelydefprefortunate.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
prefortunedefprefortu.newhois.neNigerianawiki10pp..ne
prefounderdefprefound.erwhois.erEritreaianawiki10pp..er
prefrankingdefprefranki.ngwhois.ngNigeriaianawiki11pp..ng
prefraternaldefprefratern.alwhois.alAlbaniaianawiki12pp..al
prefraternallydefprefraternal.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
prefreetradedefprefreetra.dewhois.deGermanyianawiki12pp..de
prefreezesdefprefreez.eswhois.esSpainianawiki10pp..es
prefreezingdefprefreezi.ngwhois.ngNigeriaianawiki11pp..ng
prefrenchdefprefren.chwhois.chSwitzerlandianawiki9pp..ch
prefreshmandefprefreshm.anwhois.anNetherlands Antillesianawiki11pp..an
prefriendlydefprefriend.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
prefrightdefprefrig.htwhois.htHaitiianawiki9pp..ht
prefrontaldefprefront.alwhois.alAlbaniaianawiki10pp..al
prefrontalleucotomydefprefrontalleucoto.mywhois.myMalaysiaianawiki19pp..my
prefrontallobotomydefprefrontalloboto.mywhois.myMalaysiaianawiki18pp..my
prefulgencydefprefulgen.cywhois.cyCyprusianawiki11pp..cy
prefunctionaldefprefunction.alwhois.alAlbaniaianawiki13pp..al
prefuneraldefprefuner.alwhois.alAlbaniaianawiki10pp..al
prefungoidaldefprefungoid.alwhois.alAlbaniaianawiki12pp..al
prefurloughdefprefurlou.ghwhois.ghGhanaianawiki11pp..gh
prefurnishdefprefurni.shwhois.shSaint Helenaianawiki10pp..sh
pregaindefprega.inwhois.inIndiaianawiki7pp..in
pregainerdefpregain.erwhois.erEritreaianawiki9pp..er
pregalvanizingdefpregalvanizi.ngwhois.ngNigeriaianawiki14pp..ng
pregastrulardefpregastrul.arwhois.arArgentinaianawiki12pp..ar
pregatherdefpregath.erwhois.erEritreaianawiki9pp..er
pregatheringdefpregatheri.ngwhois.ngNigeriaianawiki12pp..ng
pregeminumdefpregemin.umwhois.umUnited States Minor Outlying Islandsianawiki10pp..um
pregeneratingdefpregenerati.ngwhois.ngNigeriaianawiki13pp..ng
pregenerousdefpregenero.uswhois.usUnited Statesianawiki11pp..us
pregenerouslydefpregenerous.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
pregenialdefpregeni.alwhois.alAlbaniaianawiki9pp..al
pregeniculatumdefpregeniculat.umwhois.umUnited States Minor Outlying Islandsianawiki14pp..um
pregeniculumdefpregenicul.umwhois.umUnited States Minor Outlying Islandsianawiki12pp..um
pregenitaldefpregenit.alwhois.alAlbaniaianawiki10pp..al
pregeologicaldefpregeologic.alwhois.alAlbaniaianawiki13pp..al
pregeorgiandefpregeorgi.anwhois.anNetherlands Antillesianawiki11pp..an
pregermandefpregerm.anwhois.anNetherlands Antillesianawiki9pp..an
pregldefpre.glwhois.glGreenlandianawiki5pp..gl
preglacialdefpreglaci.alwhois.alAlbaniaianawiki10pp..al
preglenoiddefpregleno.idwhois.idIndonesiaianawiki10pp..id
preglenoidaldefpreglenoid.alwhois.alAlbaniaianawiki12pp..al
preglobulindefpreglobul.inwhois.inIndiaianawiki11pp..in
pregnanciesdefpregnanci.eswhois.esSpainianawiki11pp..es
pregnancydefpregnan.cywhois.cyCyprusianawiki9pp..cy
pregnantlydefpregnant.lywhois.lyLibyan Arab Jamahiriyaianawiki10pp..ly
pregnantwithmeaningdefpregnantwithmeani.ngwhois.ngNigeriaianawiki19pp..ng
pregnenolonedefpregnenolo.newhois.neNigerianawiki12pp..ne
pregolfingdefpregolfi.ngwhois.ngNigeriaianawiki10pp..ng
pregraciousdefpregracio.uswhois.usUnited Statesianawiki11pp..us
pregradedefpregra.dewhois.deGermanyianawiki8pp..de
pregradingdefpregradi.ngwhois.ngNigeriaianawiki10pp..ng
pregratifyingdefpregratifyi.ngwhois.ngNigeriaianawiki13pp..ng
pregreetdefpregre.etwhois.etEthiopiaianawiki8pp..et
pregreetingdefpregreeti.ngwhois.ngNigeriaianawiki11pp..ng
pregrowthdefpregrow.thwhois.thThailandianawiki9pp..th
preguaranteedefpreguarant.eewhois.eeEstoniaianawiki12pp..ee
preguaranteeingdefpreguaranteei.ngwhois.ngNigeriaianawiki15pp..ng
preguidedefpregui.dewhois.deGermanyianawiki8pp..de
preguidingdefpreguidi.ngwhois.ngNigeriaianawiki10pp..ng
preguiltdefpregui.ltwhois.ltLithuaniaianawiki8pp..lt
pregustdefpregu.stwhois.stSao Tome and Principeianawiki7pp..st
prehalterdefprehalt.erwhois.erEritreaianawiki9pp..er
prehalteresdefprehalter.eswhois.esSpainianawiki11pp..es
prehandefpreh.anwhois.anNetherlands Antillesianawiki6pp..an
prehandicappingdefprehandicappi.ngwhois.ngNigeriaianawiki15pp..ng
prehandlingdefprehandli.ngwhois.ngNigeriaianawiki11pp..ng
prehapsdefpreha.pswhois.psPalestinian Territory (Occupied)ianawiki7pp..ps
prehardenerdefpreharden.erwhois.erEritreaianawiki11pp..er
prehardeningdefprehardeni.ngwhois.ngNigeriaianawiki12pp..ng
preharmoniousdefpreharmonio.uswhois.usUnited Statesianawiki13pp..us
preharmoniouslydefpreharmonious.lywhois.lyLibyan Arab Jamahiriyaianawiki15pp..ly
preharshdefprehar.shwhois.shSaint Helenaianawiki8pp..sh
preharvestdefpreharve.stwhois.stSao Tome and Principeianawiki10pp..st
prehaustoriumdefprehaustori.umwhois.umUnited States Minor Outlying Islandsianawiki13pp..um
prehazardousdefprehazardo.uswhois.usUnited Statesianawiki12pp..us
prehealdefprehe.alwhois.alAlbaniaianawiki7pp..al
prehearingdefpreheari.ngwhois.ngNigeriaianawiki10pp..ng
preheatdefprehe.atwhois.atAustriaianawiki7pp..at
preheaterdefpreheat.erwhois.erEritreaianawiki9pp..er
preheatingdefpreheati.ngwhois.ngNigeriaianawiki10pp..ng
prehensiletaildefprehensileta.ilwhois.ilIsraelianawiki14pp..il
prehensivedefprehensi.vewhois.veVenezuelaianawiki10pp..ve
prehensorialdefprehensori.alwhois.alAlbaniaianawiki12pp..al
prehepaticusdefprehepatic.uswhois.usUnited Statesianawiki12pp..us
prehesitancydefprehesitan.cywhois.cyCyprusianawiki12pp..cy
prehesitatingdefprehesitati.ngwhois.ngNigeriaianawiki13pp..ng
prehexameraldefprehexamer.alwhois.alAlbaniaianawiki12pp..al
prehieronymiandefprehieronymi.anwhois.anNetherlands Antillesianawiki14pp..an
prehistoriandefprehistori.anwhois.anNetherlands Antillesianawiki12pp..an
prehistoricaldefprehistoric.alwhois.alAlbaniaianawiki13pp..al
prehistoricallydefprehistorical.lywhois.lyLibyan Arab Jamahiriyaianawiki15pp..ly
prehistoricanimaldefprehistoricanim.alwhois.alAlbaniaianawiki17pp..al
prehistoricanimalsdefprehistoricanima.lswhois.lsLesothoianawiki18pp..ls
prehistoricanthropologydefprehistoricanthropolo.gywhois.gyGuyanaianawiki23pp..gy
prehistoricarchaeologydefprehistoricarchaeolo.gywhois.gyGuyanaianawiki22pp..gy
prehistoricmandefprehistoricm.anwhois.anNetherlands Antillesianawiki14pp..an
prehistoricracesdefprehistoricrac.eswhois.esSpainianawiki16pp..es
prehistoricsdefprehistori.cswhois.csSerbia and Montenegroianawiki12pp..cs
prehistoriesdefprehistori.eswhois.esSpainianawiki12pp..es
preholderdefprehold.erwhois.erEritreaianawiki9pp..er
preholdingdefpreholdi.ngwhois.ngNigeriaianawiki10pp..ng
prehominiddefprehomin.idwhois.idIndonesiaianawiki10pp..id
prehumandefprehum.anwhois.anNetherlands Antillesianawiki8pp..an
prehungerdefprehung.erwhois.erEritreaianawiki9pp..er
prehypophysisdefprehypophys.iswhois.isIcelandianawiki13pp..is
preidentifyingdefpreidentifyi.ngwhois.ngNigeriaianawiki14pp..ng
preiliumdefpreili.umwhois.umUnited States Minor Outlying Islandsianawiki8pp..um
preillustratingdefpreillustrati.ngwhois.ngNigeriaianawiki15pp..ng
preimagedefpreima.gewhois.geGeorgiaianawiki8pp..ge
preimaginedefpreimagi.newhois.neNigerianawiki10pp..ne
preimaginingdefpreimagini.ngwhois.ngNigeriaianawiki12pp..ng
preimbibedefpreimbi.bewhois.beBelgiumianawiki9pp..be
preimbibingdefpreimbibi.ngwhois.ngNigeriaianawiki11pp..ng
preimbuingdefpreimbui.ngwhois.ngNigeriaianawiki10pp..ng
preimitatingdefpreimitati.ngwhois.ngNigeriaianawiki12pp..ng
preimitativedefpreimitati.vewhois.veVenezuelaianawiki12pp..ve
preimmunizesdefpreimmuniz.eswhois.esSpainianawiki12pp..es
preimmunizingdefpreimmunizi.ngwhois.ngNigeriaianawiki13pp..ng
preimpairdefpreimpa.irwhois.irIran, Islamic Republic ofianawiki9pp..ir
preimperialdefpreimperi.alwhois.alAlbaniaianawiki11pp..al
preimportantlydefpreimportant.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
preimposaldefpreimpos.alwhois.alAlbaniaianawiki10pp..al
preimposedefpreimpo.sewhois.seSwedenianawiki9pp..se
preimposingdefpreimposi.ngwhois.ngNigeriaianawiki11pp..ng
preimpressionismdefpreimpressioni.smwhois.smSan Marinoianawiki16pp..sm
preimpressionistdefpreimpressioni.stwhois.stSao Tome and Principeianawiki16pp..st
preimpressivedefpreimpressi.vewhois.veVenezuelaianawiki13pp..ve
preimprovedefpreimpro.vewhois.veVenezuelaianawiki10pp..ve
preimprovingdefpreimprovi.ngwhois.ngNigeriaianawiki12pp..ng
preinauguraldefpreinaugur.alwhois.alAlbaniaianawiki12pp..al
preinauguratingdefpreinaugurati.ngwhois.ngNigeriaianawiki15pp..ng
preincadefprein.cawhois.caCanadaianawiki7pp..ca
preincandefpreinc.anwhois.anNetherlands Antillesianawiki8pp..an
preincarialdefpreincari.alwhois.alAlbaniaianawiki11pp..al
preincentivedefpreincenti.vewhois.veVenezuelaianawiki12pp..ve
preinclinedefpreincli.newhois.neNigerianawiki10pp..ne
preincliningdefpreinclini.ngwhois.ngNigeriaianawiki12pp..ng
preincludedefpreinclu.dewhois.deGermanyianawiki10pp..de
preincludingdefpreincludi.ngwhois.ngNigeriaianawiki12pp..ng
preincorporatingdefpreincorporati.ngwhois.ngNigeriaianawiki16pp..ng
preincreasedefpreincrea.sewhois.seSwedenianawiki11pp..se
preincreasingdefpreincreasi.ngwhois.ngNigeriaianawiki13pp..ng
preindebtedlydefpreindebted.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
preindemnifyingdefpreindemnifyi.ngwhois.ngNigeriaianawiki15pp..ng
preindependentlydefpreindependent.lywhois.lyLibyan Arab Jamahiriyaianawiki16pp..ly
preindiandefpreindi.anwhois.anNetherlands Antillesianawiki9pp..an
preindicatingdefpreindicati.ngwhois.ngNigeriaianawiki13pp..ng
preindicativedefpreindicati.vewhois.veVenezuelaianawiki13pp..ve
preindisposedefpreindispo.sewhois.seSwedenianawiki12pp..se
preindisposingdefpreindisposi.ngwhois.ngNigeriaianawiki14pp..ng
preinducingdefpreinduci.ngwhois.ngNigeriaianawiki11pp..ng
preinductivedefpreinducti.vewhois.veVenezuelaianawiki12pp..ve
preindulgedefpreindul.gewhois.geGeorgiaianawiki10pp..ge
preindulgingdefpreindulgi.ngwhois.ngNigeriaianawiki12pp..ng
preindustrialdefpreindustri.alwhois.alAlbaniaianawiki13pp..al
preinferdefpreinf.erwhois.erEritreaianawiki8pp..er
preinferredpreinferringdefpreinferredpreinferri.ngwhois.ngNigeriaianawiki23pp..ng
preinflectionaldefpreinflection.alwhois.alAlbaniaianawiki15pp..al
preinhabitdefpreinhab.itwhois.itItalyianawiki10pp..it
preinheredefpreinhe.rewhois.reReunion Islandianawiki9pp..re
preinheringdefpreinheri.ngwhois.ngNigeriaianawiki11pp..ng
preinheritdefpreinher.itwhois.itItalyianawiki10pp..it
preinitialdefpreiniti.alwhois.alAlbaniaianawiki10pp..al
preinitializesdefpreinitializ.eswhois.esSpainianawiki14pp..es
preinitializingdefpreinitializi.ngwhois.ngNigeriaianawiki15pp..ng
preinitiatingdefpreinitiati.ngwhois.ngNigeriaianawiki13pp..ng
preinjuredefpreinju.rewhois.reReunion Islandianawiki9pp..re
preinjuriousdefpreinjurio.uswhois.usUnited Statesianawiki12pp..us
preinoculatesdefpreinoculat.eswhois.esSpainianawiki13pp..es
preinoculatingdefpreinoculati.ngwhois.ngNigeriaianawiki14pp..ng
preinscribedefpreinscri.bewhois.beBelgiumianawiki11pp..be
preinscribingdefpreinscribi.ngwhois.ngNigeriaianawiki13pp..ng
preinsertingdefpreinserti.ngwhois.ngNigeriaianawiki12pp..ng
preinsinuatingdefpreinsinuati.ngwhois.ngNigeriaianawiki14pp..ng
preinsinuatinglydefpreinsinuating.lywhois.lyLibyan Arab Jamahiriyaianawiki16pp..ly
preinsinuativedefpreinsinuati.vewhois.veVenezuelaianawiki14pp..ve
preinspiredefpreinspi.rewhois.reReunion Islandianawiki10pp..re
preinspiringdefpreinspiri.ngwhois.ngNigeriaianawiki12pp..ng
preinstructingdefpreinstructi.ngwhois.ngNigeriaianawiki14pp..ng
preinstructionaldefpreinstruction.alwhois.alAlbaniaianawiki16pp..al
preinstructivedefpreinstructi.vewhois.veVenezuelaianawiki14pp..ve
preinsuladefpreinsu.lawhois.laLao People's Democratic Republicianawiki9pp..la
preinsulardefpreinsul.arwhois.arArgentinaianawiki10pp..ar
preinsulatingdefpreinsulati.ngwhois.ngNigeriaianawiki13pp..ng
preinsultdefpreinsu.ltwhois.ltLithuaniaianawiki9pp..lt
preinsuredefpreinsu.rewhois.reReunion Islandianawiki9pp..re
preinsuringdefpreinsuri.ngwhois.ngNigeriaianawiki11pp..ng
preintellectualdefpreintellectu.alwhois.alAlbaniaianawiki15pp..al
preintellectuallydefpreintellectual.lywhois.lyLibyan Arab Jamahiriyaianawiki17pp..ly
preintelligentlydefpreintelligent.lywhois.lyLibyan Arab Jamahiriyaianawiki16pp..ly
preintercededefpreinterce.dewhois.deGermanyianawiki12pp..de
preintercedingdefpreintercedi.ngwhois.ngNigeriaianawiki14pp..ng
preinterchangedefpreinterchan.gewhois.geGeorgiaianawiki14pp..ge
preintercoursedefpreintercour.sewhois.seSwedenianawiki14pp..se
preinterestdefpreintere.stwhois.stSao Tome and Principeianawiki11pp..st
preinterferedefpreinterfe.rewhois.reReunion Islandianawiki12pp..re
preinterpretdefpreinterpr.etwhois.etEthiopiaianawiki12pp..et
preinterpretativedefpreinterpretati.vewhois.veVenezuelaianawiki17pp..ve
preinterruptdefpreinterru.ptwhois.ptPortugalianawiki12pp..pt
preintimatelydefpreintimate.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
preintimatingdefpreintimati.ngwhois.ngNigeriaianawiki13pp..ng
preintonedefpreinto.newhois.neNigerianawiki9pp..ne
preinvasivedefpreinvasi.vewhois.veVenezuelaianawiki11pp..ve
preinventivedefpreinventi.vewhois.veVenezuelaianawiki12pp..ve
preinventoriesdefpreinventori.eswhois.esSpainianawiki14pp..es
preinvestdefpreinve.stwhois.stSao Tome and Principeianawiki9pp..st
preinvestigatingdefpreinvestigati.ngwhois.ngNigeriaianawiki16pp..ng
preinvitingdefpreinviti.ngwhois.ngNigeriaianawiki11pp..ng
preinvolvedefpreinvol.vewhois.veVenezuelaianawiki10pp..ve
preinvolvingdefpreinvolvi.ngwhois.ngNigeriaianawiki12pp..ng
preirishdefpreiri.shwhois.shSaint Helenaianawiki8pp..sh
preirrigationaldefpreirrigation.alwhois.alAlbaniaianawiki15pp..al
preiserdefpreis.erwhois.erEritreaianawiki7pp..er
preislamdefpreisl.amwhois.amArmeniaianawiki8pp..am
preisraelitishdefpreisraeliti.shwhois.shSaint Helenaianawiki14pp..sh
preissuingdefpreissui.ngwhois.ngNigeriaianawiki10pp..ng
prejewishdefprejewi.shwhois.shSaint Helenaianawiki9pp..sh
prejohanninedefprejohanni.newhois.neNigerianawiki12pp..ne
prejohnsoniandefprejohnsoni.anwhois.anNetherlands Antillesianawiki13pp..an
prejudgedefprejud.gewhois.geGeorgiaianawiki8pp..ge
prejudgerdefprejudg.erwhois.erEritreaianawiki9pp..er
prejudgesdefprejudg.eswhois.esSpainianawiki9pp..es
prejudgingdefprejudgi.ngwhois.ngNigeriaianawiki10pp..ng
prejudicativedefprejudicati.vewhois.veVenezuelaianawiki13pp..ve
prejudiceagainstdefprejudiceagain.stwhois.stSao Tome and Principeianawiki16pp..st
prejudicedlydefprejudiced.lywhois.lyLibyan Arab Jamahiriyaianawiki12pp..ly
prejudicesdefprejudic.eswhois.esSpainianawiki10pp..es
prejudicialdefprejudici.alwhois.alAlbaniaianawiki11pp..al
prejudiciallydefprejudicial.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
prejudicingdefprejudici.ngwhois.ngNigeriaianawiki11pp..ng
prejudiciousdefprejudicio.uswhois.usUnited Statesianawiki12pp..us
prejudiciouslydefprejudicious.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
prejustifyingdefprejustifyi.ngwhois.ngNigeriaianawiki13pp..ng
prejustiniandefprejustini.anwhois.anNetherlands Antillesianawiki12pp..an
prekantiandefprekanti.anwhois.anNetherlands Antillesianawiki10pp..an
prekindlingdefprekindli.ngwhois.ngNigeriaianawiki11pp..ng
preknitdefprekn.itwhois.itItalyianawiki7pp..it
preknowingdefpreknowi.ngwhois.ngNigeriaianawiki10pp..ng
preknowledgedefpreknowled.gewhois.geGeorgiaianawiki12pp..ge
preladefpre.lawhois.laLao People's Democratic Republicianawiki5pp..la
prelabialdefprelabi.alwhois.alAlbaniaianawiki9pp..al
prelabrumdefprelabr.umwhois.umUnited States Minor Outlying Islandsianawiki9pp..um
prelachrymaldefprelachrym.alwhois.alAlbaniaianawiki12pp..al
prelaciesdefprelaci.eswhois.esSpainianawiki9pp..es
prelacrimaldefprelacrim.alwhois.alAlbaniaianawiki11pp..al
prelactealdefprelacte.alwhois.alAlbaniaianawiki10pp..al
prelacydefprela.cywhois.cyCyprusianawiki7pp..cy
prelanguagedefprelangua.gewhois.geGeorgiaianawiki11pp..ge
prelapsariandefprelapsari.anwhois.anNetherlands Antillesianawiki12pp..an
prelatenulliusdefprelatenulli.uswhois.usUnited Statesianawiki14pp..us
prelatesdefprelat.eswhois.esSpainianawiki8pp..es
prelatialdefprelati.alwhois.alAlbaniaianawiki9pp..al
prelaticaldefprelatic.alwhois.alAlbaniaianawiki10pp..al
prelaticallydefprelatical.lywhois.lyLibyan Arab Jamahiriyaianawiki12pp..ly
prelatindefprelat.inwhois.inIndiaianawiki8pp..in
prelatishdefprelati.shwhois.shSaint Helenaianawiki9pp..sh
prelatismdefprelati.smwhois.smSan Marinoianawiki9pp..sm
prelatistdefprelati.stwhois.stSao Tome and Principeianawiki9pp..st
prelaturedefprelatu.rewhois.reReunion Islandianawiki9pp..re
prelaunchdefprelaun.chwhois.chSwitzerlandianawiki9pp..ch
prelaunchingdefprelaunchi.ngwhois.ngNigeriaianawiki12pp..ng
prelaurentiandefprelaurenti.anwhois.anNetherlands Antillesianawiki13pp..an
prelawdefprel.awwhois.awArubaianawiki6pp..aw
prelawfullydefprelawful.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
preleasedefprelea.sewhois.seSwedenianawiki8pp..se
preleasingdefpreleasi.ngwhois.ngNigeriaianawiki10pp..ng
prelectingdefprelecti.ngwhois.ngNigeriaianawiki10pp..ng
prelecturedefprelectu.rewhois.reReunion Islandianawiki10pp..re
prelecturingdefprelecturi.ngwhois.ngNigeriaianawiki12pp..ng
prelegacydefprelega.cywhois.cyCyprusianawiki9pp..cy
prelegaldefpreleg.alwhois.alAlbaniaianawiki8pp..al
prelegateedefprelegat.eewhois.eeEstoniaianawiki10pp..ee
prelegislativedefprelegislati.vewhois.veVenezuelaianawiki14pp..ve
prelexicaldefprelexic.alwhois.alAlbaniaianawiki10pp..al
preliberaldefpreliber.alwhois.alAlbaniaianawiki10pp..al
preliberallydefpreliberal.lywhois.lyLibyan Arab Jamahiriyaianawiki12pp..ly
preliberatingdefpreliberati.ngwhois.ngNigeriaianawiki13pp..ng
prelicensedefprelicen.sewhois.seSwedenianawiki10pp..se
prelicensingdefprelicensi.ngwhois.ngNigeriaianawiki12pp..ng
prelimdefprel.imwhois.imIsle of Manianawiki6pp..im
preliminariesdefpreliminari.eswhois.esSpainianawiki13pp..es
preliminarilydefpreliminari.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
preliminaryapproachdefpreliminaryapproa.chwhois.chSwitzerlandianawiki19pp..ch
preliminarymeasuredefpreliminarymeasu.rewhois.reReunion Islandianawiki18pp..re
preliminarysigndefpreliminarysi.gnwhois.gnGuineaianawiki15pp..gn
preliminarysignaldefpreliminarysign.alwhois.alAlbaniaianawiki17pp..al
prelimitdefprelim.itwhois.itItalyianawiki8pp..it
prelimitatingdefprelimitati.ngwhois.ngNigeriaianawiki13pp..ng
prelimitingdefprelimiti.ngwhois.ngNigeriaianawiki11pp..ng
prelimsdefpreli.mswhois.msMontserratianawiki7pp..ms
prelingualdefprelingu.alwhois.alAlbaniaianawiki10pp..al
prelinguallydefprelingual.lywhois.lyLibyan Arab Jamahiriyaianawiki12pp..ly
prelinnaeandefprelinnae.anwhois.anNetherlands Antillesianawiki11pp..an
prelinneandefprelinne.anwhois.anNetherlands Antillesianawiki10pp..an
prelinpinpindefprelinpinp.inwhois.inIndiaianawiki12pp..in
preliquidatingdefpreliquidati.ngwhois.ngNigeriaianawiki14pp..ng
preliteraldefpreliter.alwhois.alAlbaniaianawiki10pp..al
preliterallydefpreliteral.lywhois.lyLibyan Arab Jamahiriyaianawiki12pp..ly
preliteraturedefpreliteratu.rewhois.reReunion Islandianawiki13pp..re
prelivesdefpreliv.eswhois.esSpainianawiki8pp..es
preloandefprelo.anwhois.anNetherlands Antillesianawiki7pp..an
prelocatingdefprelocati.ngwhois.ngNigeriaianawiki11pp..ng
prelogicaldefprelogic.alwhois.alAlbaniaianawiki10pp..al
preloraldefprelor.alwhois.alAlbaniaianawiki8pp..al
prelorealdefprelore.alwhois.alAlbaniaianawiki9pp..al
preluciferiandefpreluciferi.anwhois.anNetherlands Antillesianawiki13pp..an
preludedefprelu.dewhois.deGermanyianawiki7pp..de
preluderdefprelud.erwhois.erEritreaianawiki8pp..er
preludesdefprelud.eswhois.esSpainianawiki8pp..es
preludialdefpreludi.alwhois.alAlbaniaianawiki9pp..al
preludindefprelud.inwhois.inIndiaianawiki8pp..in
preludingdefpreludi.ngwhois.ngNigeriaianawiki9pp..ng
preludiodefprelud.iowhois.ioBritish Indian Ocean Territoryianawiki8pp..io
preludiousdefpreludio.uswhois.usUnited Statesianawiki10pp..us
preludiouslydefpreludious.lywhois.lyLibyan Arab Jamahiriyaianawiki12pp..ly
preludiumdefpreludi.umwhois.umUnited States Minor Outlying Islandsianawiki9pp..um
prelumbardefprelumb.arwhois.arArgentinaianawiki9pp..ar
prelunchdefprelun.chwhois.chSwitzerlandianawiki8pp..ch
prelusivedefprelusi.vewhois.veVenezuelaianawiki9pp..ve
prelusivelydefprelusive.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
prelusorilydefprelusori.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
prelutherandefpreluther.anwhois.anNetherlands Antillesianawiki11pp..an
preluxuriousdefpreluxurio.uswhois.usUnited Statesianawiki12pp..us
preluxuriouslydefpreluxurious.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
premachinedefpremachi.newhois.neNigerianawiki10pp..ne
premadedefprema.dewhois.deGermanyianawiki7pp..de
premaintaindefpremainta.inwhois.inIndiaianawiki11pp..in
premakedefprema.kewhois.keKenyaianawiki7pp..ke
premakerdefpremak.erwhois.erEritreaianawiki8pp..er
premakingdefpremaki.ngwhois.ngNigeriaianawiki9pp..ng
premalayandefpremalay.anwhois.anNetherlands Antillesianawiki10pp..an
premalaysiandefpremalaysi.anwhois.anNetherlands Antillesianawiki12pp..an
premandefprem.anwhois.anNetherlands Antillesianawiki6pp..an
premandibulardefpremandibul.arwhois.arArgentinaianawiki13pp..ar
premaniacaldefpremaniac.alwhois.alAlbaniaianawiki11pp..al
premanifestdefpremanife.stwhois.stSao Tome and Principeianawiki11pp..st
premanufacturedefpremanufactu.rewhois.reReunion Islandianawiki14pp..re
premanufacturerdefpremanufactur.erwhois.erEritreaianawiki15pp..er
premanufacturingdefpremanufacturi.ngwhois.ngNigeriaianawiki16pp..ng
premaritaldefpremarit.alwhois.alAlbaniaianawiki10pp..al
premarketingdefpremarketi.ngwhois.ngNigeriaianawiki12pp..ng
premarriagedefpremarria.gewhois.geGeorgiaianawiki11pp..ge
premarryingdefpremarryi.ngwhois.ngNigeriaianawiki11pp..ng
premarxiandefpremarxi.anwhois.anNetherlands Antillesianawiki10pp..an
prematchdefpremat.chwhois.chSwitzerlandianawiki8pp..ch
prematerialdefpremateri.alwhois.alAlbaniaianawiki11pp..al
prematingdefpremati.ngwhois.ngNigeriaianawiki9pp..ng
prematrimonialdefprematrimoni.alwhois.alAlbaniaianawiki14pp..al
prematrimoniallydefprematrimonial.lywhois.lyLibyan Arab Jamahiriyaianawiki16pp..ly
prematuredefprematu.rewhois.reReunion Islandianawiki9pp..re
prematurebabydefprematureba.bywhois.byBelarusianawiki13pp..by
prematurebeatdefprematurebe.atwhois.atAustriaianawiki13pp..at
prematurelydefpremature.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
prematuritiesdefprematuriti.eswhois.esSpainianawiki13pp..es
premaxilladefpremaxil.lawhois.laLao People's Democratic Republicianawiki10pp..la
premaxillaedefpremaxill.aewhois.aeUnited Arab Emiratesianawiki11pp..ae
premealdefpreme.alwhois.alAlbaniaianawiki7pp..al
premeasuredefpremeasu.rewhois.reReunion Islandianawiki10pp..re
premeasuringdefpremeasuri.ngwhois.ngNigeriaianawiki12pp..ng
premechanicaldefpremechanic.alwhois.alAlbaniaianawiki13pp..al
premedialdefpremedi.alwhois.alAlbaniaianawiki9pp..al
premediandefpremedi.anwhois.anNetherlands Antillesianawiki9pp..an
premedicaldefpremedic.alwhois.alAlbaniaianawiki10pp..al
premedicatingdefpremedicati.ngwhois.ngNigeriaianawiki13pp..ng
premedicsdefpremedi.cswhois.csSerbia and Montenegroianawiki9pp..cs
premedievaldefpremediev.alwhois.alAlbaniaianawiki11pp..al
premedievalismdefpremedievali.smwhois.smSan Marinoianawiki14pp..sm
premeditatedlydefpremeditated.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
premeditatesdefpremeditat.eswhois.esSpainianawiki12pp..es
premeditatingdefpremeditati.ngwhois.ngNigeriaianawiki13pp..ng
premeditatinglydefpremeditating.lywhois.lyLibyan Arab Jamahiriyaianawiki15pp..ly
premeditativedefpremeditati.vewhois.veVenezuelaianawiki13pp..ve
premeetdefpreme.etwhois.etEthiopiaianawiki7pp..et
prememorandumdefprememorand.umwhois.umUnited States Minor Outlying Islandsianawiki13pp..um
prememorandumsdefprememorandu.mswhois.msMontserratianawiki14pp..ms
premenacingdefpremenaci.ngwhois.ngNigeriaianawiki11pp..ng
premendeliandefpremendeli.anwhois.anNetherlands Antillesianawiki12pp..an
premenopausaldefpremenopaus.alwhois.alAlbaniaianawiki13pp..al
premenstrualdefpremenstru.alwhois.alAlbaniaianawiki12pp..al
premenstruallydefpremenstrual.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
premerdefprem.erwhois.erEritreaianawiki6pp..er
premeridiandefpremeridi.anwhois.anNetherlands Antillesianawiki11pp..an
premeritdefpremer.itwhois.itItalyianawiki8pp..it
premethodicaldefpremethodic.alwhois.alAlbaniaianawiki13pp..al
premethodistdefpremethodi.stwhois.stSao Tome and Principeianawiki12pp..st
premialdefpremi.alwhois.alAlbaniaianawiki7pp..al
premiatingdefpremiati.ngwhois.ngNigeriaianawiki10pp..ng
premidnightdefpremidnig.htwhois.htHaitiianawiki11pp..ht
premidsummerdefpremidsumm.erwhois.erEritreaianawiki12pp..er
premiedefprem.iewhois.ieIrelandianawiki6pp..ie
premierdefpremi.erwhois.erEritreaianawiki7pp..er
premieraldefpremier.alwhois.alAlbaniaianawiki9pp..al
premieredefpremie.rewhois.reReunion Islandianawiki8pp..re
premieredanseusedefpremieredanseu.sewhois.seSwedenianawiki16pp..se
premieresdefpremier.eswhois.esSpainianawiki9pp..es
premieringdefpremieri.ngwhois.ngNigeriaianawiki10pp..ng
premierjusdefpremierj.uswhois.usUnited Statesianawiki10pp..us
premiershipsdefpremiershi.pswhois.psPalestinian Territory (Occupied)ianawiki12pp..ps
premiesdefpremi.eswhois.esSpainianawiki7pp..es
premillenariandefpremillenari.anwhois.anNetherlands Antillesianawiki14pp..an
premillenarianismdefpremillenariani.smwhois.smSan Marinoianawiki17pp..sm
premillenialdefpremilleni.alwhois.alAlbaniaianawiki12pp..al
premillennialdefpremillenni.alwhois.alAlbaniaianawiki13pp..al
premillennialisedefpremillenniali.sewhois.seSwedenianawiki16pp..se
premillennialisingdefpremillennialisi.ngwhois.ngNigeriaianawiki18pp..ng
premillennialismdefpremillenniali.smwhois.smSan Marinoianawiki16pp..sm
premillennialistdefpremillenniali.stwhois.stSao Tome and Principeianawiki16pp..st
premillennializingdefpremillennializi.ngwhois.ngNigeriaianawiki18pp..ng
premillenniallydefpremillennial.lywhois.lyLibyan Arab Jamahiriyaianawiki15pp..ly
premillenniandefpremillenni.anwhois.anNetherlands Antillesianawiki13pp..an
premingerdefpreming.erwhois.erEritreaianawiki9pp..er
preministerdefpreminist.erwhois.erEritreaianawiki11pp..er
preministriesdefpreministri.eswhois.esSpainianawiki13pp..es
premiodefprem.iowhois.ioBritish Indian Ocean Territoryianawiki6pp..io
premiousdefpremio.uswhois.usUnited Statesianawiki8pp..us
premisdefprem.iswhois.isIcelandianawiki6pp..is
premisaldefpremis.alwhois.alAlbaniaianawiki8pp..al
premisedefpremi.sewhois.seSwedenianawiki7pp..se
premisesdefpremis.eswhois.esSpainianawiki8pp..es
premisingdefpremisi.ngwhois.ngNigeriaianawiki9pp..ng
premissesdefpremiss.eswhois.esSpainianawiki9pp..es
premitdefprem.itwhois.itItalyianawiki6pp..it
premiumdefpremi.umwhois.umUnited States Minor Outlying Islandsianawiki7pp..um
premiumgasdefpremiumg.aswhois.asAmerican Samoaianawiki10pp..as
premiumsdefpremiu.mswhois.msMontserratianawiki8pp..ms
premixerdefpremix.erwhois.erEritreaianawiki8pp..er
premixesdefpremix.eswhois.esSpainianawiki8pp..es
premixingdefpremixi.ngwhois.ngNigeriaianawiki9pp..ng
premixturedefpremixtu.rewhois.reReunion Islandianawiki10pp..re
premodelingdefpremodeli.ngwhois.ngNigeriaianawiki11pp..ng
premodifiesdefpremodifi.eswhois.esSpainianawiki11pp..es
premodifyingdefpremodifyi.ngwhois.ngNigeriaianawiki12pp..ng
premohammediandefpremohammedi.anwhois.anNetherlands Antillesianawiki14pp..an
premoisteningdefpremoisteni.ngwhois.ngNigeriaianawiki13pp..ng
premolardefpremol.arwhois.arArgentinaianawiki8pp..ar
premolderdefpremold.erwhois.erEritreaianawiki9pp..er
premoldingdefpremoldi.ngwhois.ngNigeriaianawiki10pp..ng
premoltdefpremo.ltwhois.ltLithuaniaianawiki7pp..lt
premonarchaldefpremonarch.alwhois.alAlbaniaianawiki12pp..al
premonarchialdefpremonarchi.alwhois.alAlbaniaianawiki13pp..al
premonarchicaldefpremonarchic.alwhois.alAlbaniaianawiki14pp..al
premongoliandefpremongoli.anwhois.anNetherlands Antillesianawiki12pp..an
premonishdefpremoni.shwhois.shSaint Helenaianawiki9pp..sh
premonitivedefpremoniti.vewhois.veVenezuelaianawiki11pp..ve
premonitorilydefpremonitori.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
premonitoryshiverdefpremonitoryshiv.erwhois.erEritreaianawiki17pp..er
premonitorysigndefpremonitorysi.gnwhois.gnGuineaianawiki15pp..gn
premonitorysymptomdefpremonitorysympt.omwhois.omOmanianawiki18pp..om
premonopoliesdefpremonopoli.eswhois.esSpainianawiki13pp..es
premonopolizingdefpremonopolizi.ngwhois.ngNigeriaianawiki15pp..ng
premonopolydefpremonopo.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
premonstratensiandefpremonstratensi.anwhois.anNetherlands Antillesianawiki17pp..an
premonstratensisdefpremonstratens.iswhois.isIcelandianawiki16pp..is
premonumentaldefpremonument.alwhois.alAlbaniaianawiki13pp..al
premoraldefpremor.alwhois.alAlbaniaianawiki8pp..al
premorallydefpremoral.lywhois.lyLibyan Arab Jamahiriyaianawiki10pp..ly
premorbiddefpremorb.idwhois.idIndonesiaianawiki9pp..id
premorbidlydefpremorbid.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
premorningdefpremorni.ngwhois.ngNigeriaianawiki10pp..ng
premorsedefpremor.sewhois.seSwedenianawiki8pp..se
premortaldefpremort.alwhois.alAlbaniaianawiki9pp..al
premortallydefpremortal.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
premortifyingdefpremortifyi.ngwhois.ngNigeriaianawiki13pp..ng
premoruladefpremoru.lawhois.laLao People's Democratic Republicianawiki9pp..la
premovedefpremo.vewhois.veVenezuelaianawiki7pp..ve
premoverdefpremov.erwhois.erEritreaianawiki8pp..er
premsinghgyanidefpremsinghgya.niwhois.niNicaraguaianawiki14pp..ni
premuddlingdefpremuddli.ngwhois.ngNigeriaianawiki11pp..ng
premultiplierdefpremultipli.erwhois.erEritreaianawiki13pp..er
premultiplydefpremultip.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
premultiplyingdefpremultiplyi.ngwhois.ngNigeriaianawiki14pp..ng
premundanedefpremunda.newhois.neNigerianawiki10pp..ne
premunedefpremu.newhois.neNigerianawiki7pp..ne
premunicipaldefpremunicip.alwhois.alAlbaniaianawiki12pp..al
premuniredefpremuni.rewhois.reReunion Islandianawiki9pp..re
premusicaldefpremusic.alwhois.alAlbaniaianawiki10pp..al
premusicallydefpremusical.lywhois.lyLibyan Arab Jamahiriyaianawiki12pp..ly
premuslimdefpremusl.imwhois.imIsle of Manianawiki9pp..im
premusterdefpremust.erwhois.erEritreaianawiki9pp..er
premutativedefpremutati.vewhois.veVenezuelaianawiki11pp..ve
premutiniesdefpremutini.eswhois.esSpainianawiki11pp..es
premutinyingdefpremutinyi.ngwhois.ngNigeriaianawiki12pp..ng
premycenaeandefpremycenae.anwhois.anNetherlands Antillesianawiki12pp..an
premythicaldefpremythic.alwhois.alAlbaniaianawiki11pp..al
prenamedefpre.namewhois.namePersonal Namesianawiki7pp..name
prenamesdefprenam.eswhois.esSpainianawiki8pp..es
prenanthesdefprenanth.eswhois.esSpainianawiki10pp..es
prenaresdefprenar.eswhois.esSpainianawiki8pp..es
prenarialdefprenari.alwhois.alAlbaniaianawiki9pp..al
prenarisdefprenar.iswhois.isIcelandianawiki8pp..is
prenasaldefprenas.alwhois.alAlbaniaianawiki8pp..al
prenataldefprenat.alwhois.alAlbaniaianawiki8pp..al
prenatalinformaldefprenatalinform.alwhois.alAlbaniaianawiki16pp..al
prenatalistdefprenatali.stwhois.stSao Tome and Principeianawiki11pp..st
prenatallydefprenatal.lywhois.lyLibyan Arab Jamahiriyaianawiki10pp..ly
prenationaldefprenation.alwhois.alAlbaniaianawiki11pp..al
prenativedefprenati.vewhois.veVenezuelaianawiki9pp..ve
prenaturaldefprenatur.alwhois.alAlbaniaianawiki10pp..al
prenavaldefprenav.alwhois.alAlbaniaianawiki8pp..al
prenderdefprend.erwhois.erEritreaianawiki7pp..er
prendergastdefprenderga.stwhois.stSao Tome and Principeianawiki11pp..st
prendredefprend.rewhois.reReunion Islandianawiki7pp..re
prenebulardefprenebul.arwhois.arArgentinaianawiki10pp..ar
prenecessitatingdefprenecessitati.ngwhois.ngNigeriaianawiki16pp..ng
prenegotiatingdefprenegotiati.ngwhois.ngNigeriaianawiki14pp..ng
preneuraldefpreneur.alwhois.alAlbaniaianawiki9pp..al
prenewtoniandefprenewtoni.anwhois.anNetherlands Antillesianawiki12pp..an
prenightdefprenig.htwhois.htHaitiianawiki8pp..ht
prenoachiandefprenoachi.anwhois.anNetherlands Antillesianawiki11pp..an
prenodaldefprenod.alwhois.alAlbaniaianawiki8pp..al
prenominadefprenomi.nawhois.naNamibiaianawiki9pp..na
prenominaldefprenomin.alwhois.alAlbaniaianawiki10pp..al
prenominatingdefprenominati.ngwhois.ngNigeriaianawiki13pp..ng
prenominicaldefprenominic.alwhois.alAlbaniaianawiki12pp..al
prenormandefprenorm.anwhois.anNetherlands Antillesianawiki9pp..an
prenorsedefprenor.sewhois.seSwedenianawiki8pp..se
prenotifiesdefprenotifi.eswhois.esSpainianawiki11pp..es
prenotifyingdefprenotifyi.ngwhois.ngNigeriaianawiki12pp..ng
prenotingdefprenoti.ngwhois.ngNigeriaianawiki9pp..ng
prenterdefprent.erwhois.erEritreaianawiki7pp..er
prenticesdefprentic.eswhois.esSpainianawiki9pp..es
prenticingdefprentici.ngwhois.ngNigeriaianawiki10pp..ng
prenumberdefprenumb.erwhois.erEritreaianawiki9pp..er
prenumberingdefprenumberi.ngwhois.ngNigeriaianawiki12pp..ng
prenuncialdefprenunci.alwhois.alAlbaniaianawiki10pp..al
prenuptialdefprenupti.alwhois.alAlbaniaianawiki10pp..al
prenurseriesdefprenurseri.eswhois.esSpainianawiki12pp..es
prenziedefprenz.iewhois.ieIrelandianawiki7pp..ie
preobedientlydefpreobedient.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
preobjectivedefpreobjecti.vewhois.veVenezuelaianawiki12pp..ve
preobligatingdefpreobligati.ngwhois.ngNigeriaianawiki13pp..ng
preobligedefpreobli.gewhois.geGeorgiaianawiki9pp..ge
preobligingdefpreobligi.ngwhois.ngNigeriaianawiki11pp..ng
preobservationaldefpreobservation.alwhois.alAlbaniaianawiki16pp..al
preobservedefpreobser.vewhois.veVenezuelaianawiki10pp..ve
preobservingdefpreobservi.ngwhois.ngNigeriaianawiki12pp..ng
preobtaindefpreobta.inwhois.inIndiaianawiki9pp..in
preobtrudedefpreobtru.dewhois.deGermanyianawiki10pp..de
preobtrusivedefpreobtrusi.vewhois.veVenezuelaianawiki12pp..ve
preobviatingdefpreobviati.ngwhois.ngNigeriaianawiki12pp..ng
preobviousdefpreobvio.uswhois.usUnited Statesianawiki10pp..us
preobviouslydefpreobvious.lywhois.lyLibyan Arab Jamahiriyaianawiki12pp..ly
preoccipitaldefpreoccipit.alwhois.alAlbaniaianawiki12pp..al
preoccupancydefpreoccupan.cywhois.cyCyprusianawiki12pp..cy
preoccupativedefpreoccupati.vewhois.veVenezuelaianawiki13pp..ve
preoccupiedlydefpreoccupied.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
preoccupierdefpreoccupi.erwhois.erEritreaianawiki11pp..er
preoccupiesdefpreoccupi.eswhois.esSpainianawiki11pp..es
preoccupydefpreoccu.pywhois.pyParaguayianawiki9pp..py
preoccupyingdefpreoccupyi.ngwhois.ngNigeriaianawiki12pp..ng
preoccurringdefpreoccurri.ngwhois.ngNigeriaianawiki12pp..ng
preoculardefpreocul.arwhois.arArgentinaianawiki9pp..ar
preodorousdefpreodoro.uswhois.usUnited Statesianawiki10pp..us
preoesophagealdefpreoesophage.alwhois.alAlbaniaianawiki14pp..al
preoffensedefpreoffen.sewhois.seSwedenianawiki10pp..se
preoffensivedefpreoffensi.vewhois.veVenezuelaianawiki12pp..ve
preoffensivelydefpreoffensive.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
preofferdefpreoff.erwhois.erEritreaianawiki8pp..er
preofferingdefpreofferi.ngwhois.ngNigeriaianawiki11pp..ng
preofficialdefpreoffici.alwhois.alAlbaniaianawiki11pp..al
preofficiallydefpreofficial.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
preomitdefpreom.itwhois.itItalyianawiki7pp..it
preomittingdefpreomitti.ngwhois.ngNigeriaianawiki11pp..ng
preopeningdefpreopeni.ngwhois.ngNigeriaianawiki10pp..ng
preoperatingdefpreoperati.ngwhois.ngNigeriaianawiki12pp..ng
preoperationaldefpreoperation.alwhois.alAlbaniaianawiki14pp..al
preoperativedefpreoperati.vewhois.veVenezuelaianawiki12pp..ve
preoperativelydefpreoperative.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
preoperculardefpreopercul.arwhois.arArgentinaianawiki12pp..ar
preoperculumdefpreopercul.umwhois.umUnited States Minor Outlying Islandsianawiki12pp..um
preopposedefpreoppo.sewhois.seSwedenianawiki9pp..se
preopposingdefpreopposi.ngwhois.ngNigeriaianawiki11pp..ng
preoraldefpreor.alwhois.alAlbaniaianawiki7pp..al
preorallydefpreoral.lywhois.lyLibyan Arab Jamahiriyaianawiki9pp..ly
preorbitaldefpreorbit.alwhois.alAlbaniaianawiki10pp..al
preordaindefpreorda.inwhois.inIndiaianawiki9pp..in
preordainingdefpreordaini.ngwhois.ngNigeriaianawiki12pp..ng
preorderdefpreord.erwhois.erEritreaianawiki8pp..er
preorderingdefpreorderi.ngwhois.ngNigeriaianawiki11pp..ng
preorganicallydefpreorganical.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
preorganizingdefpreorganizi.ngwhois.ngNigeriaianawiki13pp..ng
preoriginaldefpreorigin.alwhois.alAlbaniaianawiki11pp..al
preoriginallydefpreoriginal.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
preornamentaldefpreornament.alwhois.alAlbaniaianawiki13pp..al
preosmanlidefpreosman.liwhois.liLiechtensteinianawiki10pp..li
preoutfitdefpreoutf.itwhois.itItalyianawiki9pp..it
preoutfittingdefpreoutfitti.ngwhois.ngNigeriaianawiki13pp..ng
preoutlinedefpreoutli.newhois.neNigerianawiki10pp..ne
preoutliningdefpreoutlini.ngwhois.ngNigeriaianawiki12pp..ng
preoverthrowingdefpreoverthrowi.ngwhois.ngNigeriaianawiki15pp..ng
prepackdefprepa.ckwhois.ckCook Islandsianawiki7pp..ck
prepackagedefprepacka.gewhois.geGeorgiaianawiki10pp..ge
prepackagesdefprepackag.eswhois.esSpainianawiki11pp..es
prepackagingdefprepackagi.ngwhois.ngNigeriaianawiki12pp..ng
prepackingdefprepacki.ngwhois.ngNigeriaianawiki10pp..ng
prepagingdefprepagi.ngwhois.ngNigeriaianawiki9pp..ng
prepaiddefprepa.idwhois.idIndonesiaianawiki7pp..id
prepalataldefprepalat.alwhois.alAlbaniaianawiki10pp..al
prepalatinedefprepalati.newhois.neNigerianawiki11pp..ne
preparationistdefpreparationi.stwhois.stSao Tome and Principeianawiki14pp..st
preparativedefpreparati.vewhois.veVenezuelaianawiki11pp..ve
preparativelydefpreparative.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
preparativesdefpreparativ.eswhois.esSpainianawiki12pp..es
preparatorilydefpreparatori.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
preparatorymeasuredefpreparatorymeasu.rewhois.reReunion Islandianawiki18pp..re
preparedefprepa.rewhois.reReunion Islandianawiki7pp..re
prepareagainstdefprepareagain.stwhois.stSao Tome and Principeianawiki14pp..st
preparedforeithercoursedefpreparedforeithercour.sewhois.seSwedenianawiki23pp..se
preparedlydefprepared.lywhois.lyLibyan Arab Jamahiriyaianawiki10pp..ly
preparednessesdefpreparedness.eswhois.esSpainianawiki14pp..es
preparedpianodefpreparedpia.nowhois.noNorwayianawiki13pp..no
preparedspeechdefpreparedspee.chwhois.chSwitzerlandianawiki14pp..ch
prepareforburialdefprepareforburi.alwhois.alAlbaniaianawiki16pp..al
preparentaldefpreparent.alwhois.alAlbaniaianawiki11pp..al
preparerdefprepar.erwhois.erEritreaianawiki8pp..er
preparesdefprepar.eswhois.esSpainianawiki8pp..es
preparetodefprepare.towhois.toTongaianawiki9pp..to
preparietaldefprepariet.alwhois.alAlbaniaianawiki11pp..al
preparingdefprepari.ngwhois.ngNigeriaianawiki9pp..ng
preparinglydefpreparing.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
preparoccipitaldefpreparoccipit.alwhois.alAlbaniaianawiki15pp..al
preparoxysmaldefpreparoxysm.alwhois.alAlbaniaianawiki13pp..al
prepartakedefpreparta.kewhois.keKenyaianawiki10pp..ke
prepartakingdefprepartaki.ngwhois.ngNigeriaianawiki12pp..ng
prepartisandefprepartis.anwhois.anNetherlands Antillesianawiki11pp..an
prepatellardefprepatell.arwhois.arArgentinaianawiki11pp..ar
prepatriciandefprepatrici.anwhois.anNetherlands Antillesianawiki12pp..an
prepaulinedefprepauli.newhois.neNigerianawiki10pp..ne
prepavedefprepa.vewhois.veVenezuelaianawiki7pp..ve
prepavingdefprepavi.ngwhois.ngNigeriaianawiki9pp..ng
prepayingdefprepayi.ngwhois.ngNigeriaianawiki9pp..ng
prepectoraldefprepector.alwhois.alAlbaniaianawiki11pp..al
prependingdefprependi.ngwhois.ngNigeriaianawiki10pp..ng
prepenetratingdefprepenetrati.ngwhois.ngNigeriaianawiki14pp..ng
prepenialdefprepeni.alwhois.alAlbaniaianawiki9pp..al
prepensedefprepen.sewhois.seSwedenianawiki8pp..se
prepenselydefprepense.lywhois.lyLibyan Arab Jamahiriyaianawiki10pp..ly
preperceivedefprepercei.vewhois.veVenezuelaianawiki11pp..ve
preperceptivedefprepercepti.vewhois.veVenezuelaianawiki13pp..ve
preperitonealdefpreperitone.alwhois.alAlbaniaianawiki13pp..al
prepermiandefprepermi.anwhois.anNetherlands Antillesianawiki10pp..an
prepersiandefprepersi.anwhois.anNetherlands Antillesianawiki10pp..an
prepersuadedefprepersua.dewhois.deGermanyianawiki11pp..de
prepersuadingdefprepersuadi.ngwhois.ngNigeriaianawiki13pp..ng
prepersuasivedefprepersuasi.vewhois.veVenezuelaianawiki13pp..ve
preperusaldefpreperus.alwhois.alAlbaniaianawiki10pp..al
preperusedefpreperu.sewhois.seSwedenianawiki9pp..se
preperusingdefpreperusi.ngwhois.ngNigeriaianawiki11pp..ng
prepetrinedefprepetri.newhois.neNigerianawiki10pp..ne
prepgdefpre.pgwhois.pgPapua New Guineaianawiki5pp..pg
prephidiandefprephidi.anwhois.anNetherlands Antillesianawiki10pp..an
prephragmadefprephrag.mawhois.maMoroccoianawiki10pp..ma
prephthisicaldefprephthisic.alwhois.alAlbaniaianawiki13pp..al
prepigmentaldefprepigment.alwhois.alAlbaniaianawiki12pp..al
prepinealdefprepine.alwhois.alAlbaniaianawiki9pp..al
prepiousdefprepio.uswhois.usUnited Statesianawiki8pp..us
prepiouslydefprepious.lywhois.lyLibyan Arab Jamahiriyaianawiki10pp..ly
preplacentaldefpreplacent.alwhois.alAlbaniaianawiki12pp..al
preplacesdefpreplac.eswhois.esSpainianawiki9pp..es
preplacingdefpreplaci.ngwhois.ngNigeriaianawiki10pp..ng
preplandefprepl.anwhois.anNetherlands Antillesianawiki7pp..an
preplanningdefpreplanni.ngwhois.ngNigeriaianawiki11pp..ng
preplantingdefpreplanti.ngwhois.ngNigeriaianawiki11pp..ng
prepledgedefprepled.gewhois.geGeorgiaianawiki9pp..ge
prepledgingdefprepledgi.ngwhois.ngNigeriaianawiki11pp..ng
preplottingdefpreplotti.ngwhois.ngNigeriaianawiki11pp..ng
prepndefpre.pnwhois.pnPitcairn Islandianawiki5pp..pn
prepnetdefprepn.etwhois.etEthiopiaianawiki7pp..et
prepnetdefprep.netwhois.netNetworksianawiki7pp..net
prepoeticaldefprepoetic.alwhois.alAlbaniaianawiki11pp..al
prepolishdefprepoli.shwhois.shSaint Helenaianawiki9pp..sh
prepoliticaldefprepolitic.alwhois.alAlbaniaianawiki12pp..al
prepoliticallydefprepolitical.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
prepollencydefprepollen.cywhois.cyCyprusianawiki11pp..cy
prepollicesdefprepollic.eswhois.esSpainianawiki11pp..es
preponderdefprepond.erwhois.erEritreaianawiki9pp..er
preponderancesdefpreponderanc.eswhois.esSpainianawiki14pp..es
preponderancydefpreponderan.cywhois.cyCyprusianawiki13pp..cy
preponderantlydefpreponderant.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
preponderatelydefpreponderate.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
preponderatesdefpreponderat.eswhois.esSpainianawiki13pp..es
preponderatingdefpreponderati.ngwhois.ngNigeriaianawiki14pp..ng
preponderatinglydefpreponderating.lywhois.lyLibyan Arab Jamahiriyaianawiki16pp..ly
preponderousdefprepondero.uswhois.usUnited Statesianawiki12pp..us
preponderouslydefpreponderous.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
prepontinedefpreponti.newhois.neNigerianawiki10pp..ne
preportrayaldefpreportray.alwhois.alAlbaniaianawiki12pp..al
preposedefprepo.sewhois.seSwedenianawiki7pp..se
preposingdefpreposi.ngwhois.ngNigeriaianawiki9pp..ng
prepositionaldefpreposition.alwhois.alAlbaniaianawiki13pp..al
prepositionallydefprepositional.lywhois.lyLibyan Arab Jamahiriyaianawiki15pp..ly
prepositionalphrasedefprepositionalphra.sewhois.seSwedenianawiki19pp..se
prepositivedefprepositi.vewhois.veVenezuelaianawiki11pp..ve
prepositivelydefprepositive.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
prepositorialdefprepositori.alwhois.alAlbaniaianawiki13pp..al
preposituredefprepositu.rewhois.reReunion Islandianawiki11pp..re
prepossessesdefprepossess.eswhois.esSpainianawiki12pp..es
prepossessingdefprepossessi.ngwhois.ngNigeriaianawiki13pp..ng
prepossessinglydefprepossessing.lywhois.lyLibyan Arab Jamahiriyaianawiki15pp..ly
preposterdefprepost.erwhois.erEritreaianawiki9pp..er
preposterousdefprepostero.uswhois.usUnited Statesianawiki12pp..us
preposterouslydefpreposterous.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
prepotencydefprepoten.cywhois.cyCyprusianawiki10pp..cy
prepotentialdefprepotenti.alwhois.alAlbaniaianawiki12pp..al
prepotentlydefprepotent.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
preppiedefprepp.iewhois.ieIrelandianawiki7pp..ie
preppierdefpreppi.erwhois.erEritreaianawiki8pp..er
preppiesdefpreppi.eswhois.esSpainianawiki8pp..es
preppilydefpreppi.lywhois.lyLibyan Arab Jamahiriyaianawiki8pp..ly
preppingdefpreppi.ngwhois.ngNigeriaianawiki8pp..ng
preppydefprep.pywhois.pyParaguayianawiki6pp..py
prepracticaldefprepractic.alwhois.alAlbaniaianawiki12pp..al
prepracticingdefprepractici.ngwhois.ngNigeriaianawiki13pp..ng
prepractisedefprepracti.sewhois.seSwedenianawiki11pp..se
prepractisingdefprepractisi.ngwhois.ngNigeriaianawiki13pp..ng
preprandialdefpreprandi.alwhois.alAlbaniaianawiki11pp..al
prepregdefprepr.egwhois.egEgyptianawiki7pp..eg
prepregsdefprepre.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki8pp..gs
prepricingdefpreprici.ngwhois.ngNigeriaianawiki10pp..ng
preprimerdefpreprim.erwhois.erEritreaianawiki9pp..er
preprimitivedefpreprimiti.vewhois.veVenezuelaianawiki12pp..ve
preprintdefprepr.intwhois.intInternational Organizationsianawiki8pp..int
preprintingdefpreprinti.ngwhois.ngNigeriaianawiki11pp..ng
preprocessesdefpreprocess.eswhois.esSpainianawiki12pp..es
preprocessingdefpreprocessi.ngwhois.ngNigeriaianawiki13pp..ng
preprofessionaldefpreprofession.alwhois.alAlbaniaianawiki15pp..al
preprogramdefpreprogr.amwhois.amArmeniaianawiki10pp..am
prepromisedefprepromi.sewhois.seSwedenianawiki10pp..se
prepromisingdefprepromisi.ngwhois.ngNigeriaianawiki12pp..ng
prepromotingdefprepromoti.ngwhois.ngNigeriaianawiki12pp..ng
prepronouncingdefprepronounci.ngwhois.ngNigeriaianawiki14pp..ng
preprovedefprepro.vewhois.veVenezuelaianawiki8pp..ve
preprovidedefpreprovi.dewhois.deGermanyianawiki10pp..de
preprovidingdefpreprovidi.ngwhois.ngNigeriaianawiki12pp..ng
preprovokedefpreprovo.kewhois.keKenyaianawiki10pp..ke
preprovokingdefpreprovoki.ngwhois.ngNigeriaianawiki12pp..ng
preprudentlydefpreprudent.lywhois.lyLibyan Arab Jamahiriyaianawiki12pp..ly
prepsdefpre.pswhois.psPalestinian Territory (Occupied)ianawiki5pp..ps
prepschoolerdefprepschool.erwhois.erEritreaianawiki12pp..er
prepsychologicaldefprepsychologic.alwhois.alAlbaniaianawiki16pp..al
prepsychologydefprepsycholo.gywhois.gyGuyanaianawiki13pp..gy
prepuberaldefprepuber.alwhois.alAlbaniaianawiki10pp..al
prepuberallydefprepuberal.lywhois.lyLibyan Arab Jamahiriyaianawiki12pp..ly
prepubertaldefprepubert.alwhois.alAlbaniaianawiki11pp..al
prepubertallydefprepubertal.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
prepubisdefprepub.iswhois.isIcelandianawiki8pp..is
prepublishdefprepubli.shwhois.shSaint Helenaianawiki10pp..sh
prepucesdefprepuc.eswhois.esSpainianawiki8pp..es
prepuebloandefprepueblo.anwhois.anNetherlands Antillesianawiki11pp..an
prepunchdefprepun.chwhois.chSwitzerlandianawiki8pp..ch
prepunchesdefprepunch.eswhois.esSpainianawiki10pp..es
prepunchingdefprepunchi.ngwhois.ngNigeriaianawiki11pp..ng
prepunctualdefprepunctu.alwhois.alAlbaniaianawiki11pp..al
prepunishdefprepuni.shwhois.shSaint Helenaianawiki9pp..sh
prepupadefprepu.pawhois.paPanamaianawiki7pp..pa
prepupaldefprepup.alwhois.alAlbaniaianawiki8pp..al
prepurchasedefprepurcha.sewhois.seSwedenianawiki11pp..se
prepurchaserdefprepurchas.erwhois.erEritreaianawiki12pp..er
prepurchasesdefprepurchas.eswhois.esSpainianawiki12pp..es
prepurchasingdefprepurchasi.ngwhois.ngNigeriaianawiki13pp..ng
prepurposedefprepurpo.sewhois.seSwedenianawiki10pp..se
prepurposingdefprepurposi.ngwhois.ngNigeriaianawiki12pp..ng
prepurposivedefprepurposi.vewhois.veVenezuelaianawiki12pp..ve
preputialdefpreputi.alwhois.alAlbaniaianawiki9pp..al
preputiumdefpreputi.umwhois.umUnited States Minor Outlying Islandsianawiki9pp..um
prepyramidaldefprepyramid.alwhois.alAlbaniaianawiki12pp..al
prequalifyingdefprequalifyi.ngwhois.ngNigeriaianawiki13pp..ng
prequarantinedefprequaranti.newhois.neNigerianawiki13pp..ne
prequarantiningdefprequarantini.ngwhois.ngNigeriaianawiki15pp..ng
prequotingdefprequoti.ngwhois.ngNigeriaianawiki10pp..ng
preracingdefpreraci.ngwhois.ngNigeriaianawiki9pp..ng
preradiodefprerad.iowhois.ioBritish Indian Ocean Territoryianawiki8pp..io
prerailroaddefprerailro.adwhois.adAndorraianawiki11pp..ad
preramusdefpreram.uswhois.usUnited Statesianawiki8pp..us
preraphaelismdefpreraphaeli.smwhois.smSan Marinoianawiki13pp..sm
preraphaelitishdefpreraphaeliti.shwhois.shSaint Helenaianawiki15pp..sh
preraphaelitismdefpreraphaeliti.smwhois.smSan Marinoianawiki15pp..sm
prerationaldefpreration.alwhois.alAlbaniaianawiki11pp..al
prerealizingdefprerealizi.ngwhois.ngNigeriaianawiki12pp..ng
prereceiptdefprerecei.ptwhois.ptPortugalianawiki10pp..pt
prereceivedefprerecei.vewhois.veVenezuelaianawiki10pp..ve
prereceiverdefprereceiv.erwhois.erEritreaianawiki11pp..er
prereceivingdefprereceivi.ngwhois.ngNigeriaianawiki12pp..ng
prerecitaldefprerecit.alwhois.alAlbaniaianawiki10pp..al
prerecitingdefprereciti.ngwhois.ngNigeriaianawiki11pp..ng
prereckoningdefprereckoni.ngwhois.ngNigeriaianawiki12pp..ng
prerecognizingdefprerecognizi.ngwhois.ngNigeriaianawiki14pp..ng
prereconcilingdefprereconcili.ngwhois.ngNigeriaianawiki14pp..ng
prerecordingdefprerecordi.ngwhois.ngNigeriaianawiki12pp..ng
prerectaldefprerect.alwhois.alAlbaniaianawiki9pp..al
prereferdefpreref.erwhois.erEritreaianawiki8pp..er
prereferringdefprereferri.ngwhois.ngNigeriaianawiki12pp..ng
prerefinedefprerefi.newhois.neNigerianawiki9pp..ne
prerefiningdefprerefini.ngwhois.ngNigeriaianawiki11pp..ng
prerefusaldefprerefus.alwhois.alAlbaniaianawiki10pp..al
prerefusedefprerefu.sewhois.seSwedenianawiki9pp..se
prerefusingdefprerefusi.ngwhois.ngNigeriaianawiki11pp..ng
preregaldefprereg.alwhois.alAlbaniaianawiki8pp..al
preregisterdefpreregist.erwhois.erEritreaianawiki11pp..er
preregisteringdefpreregisteri.ngwhois.ngNigeriaianawiki14pp..ng
preregulatingdefpreregulati.ngwhois.ngNigeriaianawiki13pp..ng
prerehearsaldefprerehears.alwhois.alAlbaniaianawiki12pp..al
prerejoicingdefprerejoici.ngwhois.ngNigeriaianawiki12pp..ng
prerelatingdefprerelati.ngwhois.ngNigeriaianawiki11pp..ng
prereleasedefprerelea.sewhois.seSwedenianawiki10pp..se
prereligiousdefprereligio.uswhois.usUnited Statesianawiki12pp..us
preremitdefprerem.itwhois.itItalyianawiki8pp..it
preremittingdefpreremitti.ngwhois.ngNigeriaianawiki12pp..ng
preremorsedefpreremor.sewhois.seSwedenianawiki10pp..se
preremovaldefpreremov.alwhois.alAlbaniaianawiki10pp..al
preremovedefpreremo.vewhois.veVenezuelaianawiki9pp..ve
preremovingdefpreremovi.ngwhois.ngNigeriaianawiki11pp..ng
preremuneratingdefpreremunerati.ngwhois.ngNigeriaianawiki15pp..ng
prerenaldefpreren.alwhois.alAlbaniaianawiki8pp..al
prerentaldefprerent.alwhois.alAlbaniaianawiki9pp..al
prereproductivedefprereproducti.vewhois.veVenezuelaianawiki15pp..ve
prerepublicandefprerepublic.anwhois.anNetherlands Antillesianawiki13pp..an
prerequestdefprereque.stwhois.stSao Tome and Principeianawiki10pp..st
prerequiredefprerequi.rewhois.reReunion Islandianawiki10pp..re
prerequiringdefprerequiri.ngwhois.ngNigeriaianawiki12pp..ng
prerequisitesdefprerequisit.eswhois.esSpainianawiki13pp..es
preresemblingdefpreresembli.ngwhois.ngNigeriaianawiki13pp..ng
preresolvedefpreresol.vewhois.veVenezuelaianawiki10pp..ve
preresolvingdefpreresolvi.ngwhois.ngNigeriaianawiki12pp..ng
prerespiredefprerespi.rewhois.reReunion Islandianawiki10pp..re
prerestraindefprerestra.inwhois.inIndiaianawiki11pp..in
prerestraintdefprerestra.intwhois.intInternational Organizationsianawiki12pp..int
prerevealdefprereve.alwhois.alAlbaniaianawiki9pp..al
prerevengedefprereven.gewhois.geGeorgiaianawiki10pp..ge
prerevengingdefprerevengi.ngwhois.ngNigeriaianawiki12pp..ng
prereversaldefprerevers.alwhois.alAlbaniaianawiki11pp..al
prereversedefprerever.sewhois.seSwedenianawiki10pp..se
prereversingdefprereversi.ngwhois.ngNigeriaianawiki12pp..ng
prerevisedefprerevi.sewhois.seSwedenianawiki9pp..se
prerevisingdefprerevisi.ngwhois.ngNigeriaianawiki11pp..ng
prerevivaldefprereviv.alwhois.alAlbaniaianawiki10pp..al
prerichdefpreri.chwhois.chSwitzerlandianawiki7pp..ch
prerighteousdefprerighteo.uswhois.usUnited Statesianawiki12pp..us
prerighteouslydefprerighteous.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
prerinsedefprerin.sewhois.seSwedenianawiki8pp..se
prerockdefprero.ckwhois.ckCook Islandsianawiki7pp..ck
prerogativaldefprerogativ.alwhois.alAlbaniaianawiki12pp..al
prerogativedefprerogati.vewhois.veVenezuelaianawiki11pp..ve
prerogativelydefprerogative.lywhois.lyLibyan Arab Jamahiriyaianawiki13pp..ly
prerogativesdefprerogativ.eswhois.esSpainianawiki12pp..es
prerogativewritdefprerogativewr.itwhois.itItalyianawiki15pp..it
preromandefprerom.anwhois.anNetherlands Antillesianawiki8pp..an
preromanticismdefpreromantici.smwhois.smSan Marinoianawiki14pp..sm
preroutinedefprerouti.newhois.neNigerianawiki10pp..ne
preroutingdefprerouti.ngwhois.ngNigeriaianawiki10pp..ng
preroyaldefpreroy.alwhois.alAlbaniaianawiki8pp..al
preroyallydefpreroyal.lywhois.lyLibyan Arab Jamahiriyaianawiki10pp..ly
preruptdefpreru.ptwhois.ptPortugalianawiki7pp..pt
presdefpr.eswhois.esSpainianawiki4pp..es
presadefpre.sawhois.saSaudi Arabiaianawiki5pp..sa
presacraldefpresacr.alwhois.alAlbaniaianawiki9pp..al
presacrificialdefpresacrifici.alwhois.alAlbaniaianawiki14pp..al
presacrificingdefpresacrifici.ngwhois.ngNigeriaianawiki14pp..ng
presagedefpresa.gewhois.geGeorgiaianawiki7pp..ge
presagefullydefpresageful.lywhois.lyLibyan Arab Jamahiriyaianawiki12pp..ly
presagerdefpresag.erwhois.erEritreaianawiki8pp..er
presagesdefpresag.eswhois.esSpainianawiki8pp..es
presagingdefpresagi.ngwhois.ngNigeriaianawiki9pp..ng
presaginglydefpresaging.lywhois.lyLibyan Arab Jamahiriyaianawiki11pp..ly
presaiddefpresa.idwhois.idIndonesiaianawiki7pp..id
presanctifyingdefpresanctifyi.ngwhois.ngNigeriaianawiki14pp..ng
presanguinedefpresangui.newhois.neNigerianawiki11pp..ne
presartorialdefpresartori.alwhois.alAlbaniaianawiki12pp..al
presatisfyingdefpresatisfyi.ngwhois.ngNigeriaianawiki13pp..ng
presavagedefpresava.gewhois.geGeorgiaianawiki9pp..ge
presawdefpres.awwhois.awArubaianawiki6pp..aw
presayingdefpresayi.ngwhois.ngNigeriaianawiki9pp..ng
presbdefpre.sbwhois.sbSolomon Islandsianawiki5pp..sb
presberdefpresb.erwhois.erEritreaianawiki7pp..er
presbydefpres.bywhois.byBelarusianawiki6pp..by
presbycousisdefpresbycous.iswhois.isIcelandianawiki12pp..is
presbycusisdefpresbycus.iswhois.isIcelandianawiki11pp..is
presbyopedefpresbyo.pewhois.pePeruianawiki9pp..pe
presbyopydefpresbyo.pywhois.pyParaguayianawiki9pp..py
presbytdefpresb.ytwhois.ytMayotteianawiki7pp..yt
presbyterdefpresbyt.erwhois.erEritreaianawiki9pp..er
presbyteraldefpresbyter.alwhois.alAlbaniaianawiki11pp..al
presbyteredefpresbyte.rewhois.reReunion Islandianawiki10pp..re
presbyterialdefpresbyteri.alwhois.alAlbaniaianawiki12pp..al
presbyteriallydefpresbyterial.lywhois.lyLibyan Arab Jamahiriyaianawiki14pp..ly
presbyteriandefpresbyteri.an