Xona.comDomain HacksSuggest


Over 300,000 domain hack suggestions.
[an error occurred while processing this directive]

There are 2,473 domain hacks for words that start with ta.
First Letter: number A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Second Letter: number A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Word Domain Name Top-Level Domain Filter
Word Definition Domain Whois TLD Description IANA Wikipedia Length TLD
taaldefta.alwhois.alAlbaniaianawiki4tt..al
taamdefta.amwhois.amArmeniaianawiki4tt..am
taardefta.arwhois.arArgentinaianawiki4tt..ar
tabacdeftab.acwhois.acAscension Islandianawiki5tt..ac
tabaccodeftabac.cowhois.coColombiaianawiki7tt..co
tabacindeftabac.inwhois.inIndiaianawiki7tt..in
tabacismdeftabaci.smwhois.smSan Marinoianawiki8tt..sm
tabacosisdeftabacos.iswhois.isIcelandianawiki9tt..is
tabacumdeftabac.umwhois.umUnited States Minor Outlying Islandsianawiki7tt..um
tabagiedeftabag.iewhois.ieIrelandianawiki7tt..ie
tabagismdeftabagi.smwhois.smSan Marinoianawiki8tt..sm
tabaniddeftaban.idwhois.idIndonesiaianawiki7tt..id
tabanidaedeftabanid.aewhois.aeUnited Arab Emiratesianawiki9tt..ae
tabanputehdeftabanput.ehwhois.ehWestern Saharaianawiki10tt..eh
tabanucodeftabanu.cowhois.coColombiaianawiki8tt..co
tabanusdeftaban.uswhois.usUnited Statesianawiki7tt..us
tabaretdeftabar.etwhois.etEthiopiaianawiki7tt..et
tabascodeftabas.cowhois.coColombiaianawiki7tt..co
tabascodeftaba.scowhois.scoScots languageN/Awiki7tt..sco
tabasheerdeftabashe.erwhois.erEritreaianawiki9tt..er
tabashirdeftabash.irwhois.irIran, Islamic Republic ofianawiki8tt..ir
tabatieredeftabatie.rewhois.reReunion Islandianawiki9tt..re
tabaxirdeftabax.irwhois.irIran, Islamic Republic ofianawiki7tt..ir
tabbdefta.bbwhois.bbBarbadosianawiki4tt..bb
tabberdeftabb.erwhois.erEritreaianawiki6tt..er
tabbideftab.biwhois.biBurundiianawiki5tt..bi
tabbiedeftabb.iewhois.ieIrelandianawiki6tt..ie
tabbiesdeftabbi.eswhois.esSpainianawiki7tt..es
tabbinetdeftabbin.etwhois.etEthiopiaianawiki8tt..et
tabbinetdeftabbi.netwhois.netNetworksianawiki8tt..net
tabbingdeftabbi.ngwhois.ngNigeriaianawiki7tt..ng
tabbisdeftabb.iswhois.isIcelandianawiki6tt..is
tabbisesdeftabbis.eswhois.esSpainianawiki8tt..es
tabbydeftab.bywhois.byBelarusianawiki5tt..by
tabbycatdeftabbyc.atwhois.atAustriaianawiki8tt..at
tabbycatdeftabby.catwhois.catCatalan languageN/Awiki8tt..cat
tabbyingdeftabbyi.ngwhois.ngNigeriaianawiki8tt..ng
tabbymothdeftabbymo.thwhois.thThailandianawiki9tt..th
tabbyweavedeftabbywea.vewhois.veVenezuelaianawiki10tt..ve
tabelladeftabel.lawhois.laLao People's Democratic Republicianawiki7tt..la
tabellariaceaedeftabellariace.aewhois.aeUnited Arab Emiratesianawiki14tt..ae
taberdeftab.erwhois.erEritreaianawiki5tt..er
taberdardeftaberd.arwhois.arArgentinaianawiki8tt..ar
taberingdeftaberi.ngwhois.ngNigeriaianawiki8tt..ng
tabernadeftaber.nawhois.naNamibiaianawiki7tt..na
tabernaclerdeftabernacl.erwhois.erEritreaianawiki11tt..er
tabernaclesdeftabernacl.eswhois.esSpainianawiki11tt..es
tabernaclingdeftabernacli.ngwhois.ngNigeriaianawiki12tt..ng
tabernaculardeftabernacul.arwhois.arArgentinaianawiki12tt..ar
tabernaedeftabern.aewhois.aeUnited Arab Emiratesianawiki8tt..ae
tabernaemontanadeftabernaemonta.nawhois.naNamibiaianawiki15tt..na
tabernariaedeftabernari.aewhois.aeUnited Arab Emiratesianawiki11tt..ae
tabernashdeftaberna.shwhois.shSaint Helenaianawiki9tt..sh
tabesdeftab.eswhois.esSpainianawiki5tt..es
tabesdorsalesdeftabesdorsal.eswhois.esSpainianawiki13tt..es
tabesdorsalisdeftabesdorsal.iswhois.isIcelandianawiki13tt..is
tabetdeftab.etwhois.etEthiopiaianawiki5tt..et
tabeticsdeftabeti.cswhois.csSerbia and Montenegroianawiki8tt..cs
tabidefta.biwhois.biBurundiianawiki4tt..bi
tabiddeftab.idwhois.idIndonesiaianawiki5tt..id
tabidlydeftabid.lywhois.lyLibyan Arab Jamahiriyaianawiki7tt..ly
tabificaldeftabific.alwhois.alAlbaniaianawiki9tt..al
tabinadeftabi.nawhois.naNamibiaianawiki6tt..na
tabinetdeftabin.etwhois.etEthiopiaianawiki7tt..et
tabinetdeftabi.netwhois.netNetworksianawiki7tt..net
tabionadeftabio.nawhois.naNamibiaianawiki7tt..na
tabisdeftab.iswhois.isIcelandianawiki5tt..is
tabitudedeftabitu.dewhois.deGermanyianawiki8tt..de
tabladeftab.lawhois.laLao People's Democratic Republicianawiki5tt..la
tablasdeftabl.aswhois.asAmerican Samoaianawiki6tt..as
tablaturedeftablatu.rewhois.reReunion Islandianawiki9tt..re
tableaudeftable.auwhois.auAustraliaianawiki7tt..au
tableaucurtaindeftableaucurta.inwhois.inIndiaianawiki14tt..in
tableausdeftablea.uswhois.usUnited Statesianawiki8tt..us
tablebasedeftableba.sewhois.seSwedenianawiki9tt..se
tablechairdeftablecha.irwhois.irIran, Islamic Republic ofianawiki10tt..ir
tableclothdeftableclo.thwhois.thThailandianawiki10tt..th
tableclothingdeftableclothi.ngwhois.ngNigeriaianawiki13tt..ng
tableclothwisedeftableclothwi.sewhois.seSwedenianawiki14tt..se
tablecoverdeftablecov.erwhois.erEritreaianawiki10tt..er
tablecutterdeftablecutt.erwhois.erEritreaianawiki11tt..er
tablecuttingdeftablecutti.ngwhois.ngNigeriaianawiki12tt..ng
tabledjointdeftabledjo.intwhois.intInternational Organizationsianawiki11tt..int
tableenginedeftableengi.newhois.neNigerianawiki11tt..ne
tablefulsdeftablefu.lswhois.lsLesothoianawiki9tt..ls
tablehopperdeftablehopp.erwhois.erEritreaianawiki11tt..er
tablehoppingdeftablehoppi.ngwhois.ngNigeriaianawiki12tt..ng
tablelampdeftablela.mpwhois.mpNorthern Mariana Islandsianawiki9tt..mp
tablelikedeftableli.kewhois.keKenyaianawiki9tt..ke
tablelinedeftableli.newhois.neNigerianawiki9tt..ne
tablemaiddeftablema.idwhois.idIndonesiaianawiki9tt..id
tablemakerdeftablemak.erwhois.erEritreaianawiki10tt..er
tablemakingdeftablemaki.ngwhois.ngNigeriaianawiki11tt..ng
tablemandeftablem.anwhois.anNetherlands Antillesianawiki8tt..an
tablemountaindeftablemounta.inwhois.inIndiaianawiki13tt..in
tablemountainpinedeftablemountainpi.newhois.neNigerianawiki17tt..ne
tablemountainseriesdeftablemountainseri.eswhois.esSpainianawiki19tt..es
tablenapkindeftablenapk.inwhois.inIndiaianawiki11tt..in
tableofprothesisdeftableofprothes.iswhois.isIcelandianawiki16tt..is
tableoildeftableo.ilwhois.ilIsraelianawiki8tt..il
tablerdeftabl.erwhois.erEritreaianawiki6tt..er
tableradiodeftablerad.iowhois.ioBritish Indian Ocean Territoryianawiki10tt..io
tablerappingdeftablerappi.ngwhois.ngNigeriaianawiki12tt..ng
tablerubydeftableru.bywhois.byBelarusianawiki9tt..by
tablesdeftabl.eswhois.esSpainianawiki6tt..es
tablesaltdeftablesa.ltwhois.ltLithuaniaianawiki9tt..lt
tablesawdeftables.awwhois.awArubaianawiki8tt..aw
tablesettingdeftablesetti.ngwhois.ngNigeriaianawiki12tt..ng
tablespardeftablesp.arwhois.arArgentinaianawiki9tt..ar
tablespoonfulsdeftablespoonfu.lswhois.lsLesothoianawiki14tt..ls
tablestakedeftablesta.kewhois.keKenyaianawiki10tt..ke
tablestonedeftablesto.newhois.neNigerianawiki10tt..ne
tabletdeftabl.etwhois.etEthiopiaianawiki6tt..et
tabletaildeftableta.ilwhois.ilIsraelianawiki9tt..il
tabletalkdeftableta.lkwhois.lkSri Lankaianawiki9tt..lk
tabletalkerdeftabletalk.erwhois.erEritreaianawiki11tt..er
tabletchairdeftabletcha.irwhois.irIran, Islamic Republic ofianawiki11tt..ir
tabletennisdeftabletenn.iswhois.isIcelandianawiki11tt..is
tabletiltingdeftabletilti.ngwhois.ngNigeriaianawiki12tt..ng
tabletingdeftableti.ngwhois.ngNigeriaianawiki9tt..ng
tabletippingdeftabletippi.ngwhois.ngNigeriaianawiki12tt..ng
tabletletterdeftabletlett.erwhois.erEritreaianawiki12tt..er
tabletopsdeftableto.pswhois.psPalestinian Territory (Occupied)ianawiki9tt..ps
tablettingdeftabletti.ngwhois.ngNigeriaianawiki10tt..ng
tableturningdeftableturni.ngwhois.ngNigeriaianawiki12tt..ng
tablewaredeftablewa.rewhois.reReunion Islandianawiki9tt..re
tablewaresdeftablewar.eswhois.esSpainianawiki10tt..es
tablewinedeftablewi.newhois.neNigerianawiki9tt..ne
tablewisedeftablewi.sewhois.seSwedenianawiki9tt..se
tablierdeftabli.erwhois.erEritreaianawiki7tt..er
tablinadeftabli.nawhois.naNamibiaianawiki7tt..na
tablingdeftabli.ngwhois.ngNigeriaianawiki7tt..ng
tablinumdeftablin.umwhois.umUnited States Minor Outlying Islandsianawiki8tt..um
tabloiddeftablo.idwhois.idIndonesiaianawiki7tt..id
tabooingdeftabooi.ngwhois.ngNigeriaianawiki8tt..ng
tabooismdeftabooi.smwhois.smSan Marinoianawiki8tt..sm
tabooistdeftabooi.stwhois.stSao Tome and Principeianawiki8tt..st
taboolanguagedeftaboolangua.gewhois.geGeorgiaianawiki13tt..ge
taboparalysisdeftaboparalys.iswhois.isIcelandianawiki13tt..is
taboparesisdeftabopares.iswhois.isIcelandianawiki11tt..is
taborerdeftabor.erwhois.erEritreaianawiki7tt..er
taboretdeftabor.etwhois.etEthiopiaianawiki7tt..et
taborindeftabor.inwhois.inIndiaianawiki7tt..in
taborinedeftabori.newhois.neNigerianawiki8tt..ne
taborinesdeftaborin.eswhois.esSpainianawiki9tt..es
taboringdeftabori.ngwhois.ngNigeriaianawiki8tt..ng
taborpipedeftaborpi.pewhois.pePeruianawiki9tt..pe
taboulideftabou.liwhois.liLiechtensteinianawiki7tt..li
taboulisdeftaboul.iswhois.isIcelandianawiki8tt..is
tabourerdeftabour.erwhois.erEritreaianawiki8tt..er
tabouretdeftabour.etwhois.etEthiopiaianawiki8tt..et
tabourindeftabour.inwhois.inIndiaianawiki8tt..in
tabourinedeftabouri.newhois.neNigerianawiki9tt..ne
tabouringdeftabouri.ngwhois.ngNigeriaianawiki9tt..ng
tabretdeftabr.etwhois.etEthiopiaianawiki6tt..et
tabsdefta.bswhois.bsBahamasianawiki4tt..bs
tabstopsdeftabsto.pswhois.psPalestinian Territory (Occupied)ianawiki8tt..ps
tabudefta.buwhois.buBurmaN/Awiki4tt..bu
tabuingdeftabui.ngwhois.ngNigeriaianawiki7tt..ng
tabuladeftabu.lawhois.laLao People's Democratic Republicianawiki6tt..la
tabulaamalfitanadeftabulaamalfita.nawhois.naNamibiaianawiki16tt..na
tabulaedeftabul.aewhois.aeUnited Arab Emiratesianawiki7tt..ae
tabulardeftabul.arwhois.arArgentinaianawiki7tt..ar
tabularasadeftabulara.sawhois.saSaudi Arabiaianawiki10tt..sa
tabularedeftabula.rewhois.reReunion Islandianawiki8tt..re
tabularisedeftabulari.sewhois.seSwedenianawiki10tt..se
tabularisingdeftabularisi.ngwhois.ngNigeriaianawiki12tt..ng
tabulariumdeftabulari.umwhois.umUnited States Minor Outlying Islandsianawiki10tt..um
tabularizingdeftabularizi.ngwhois.ngNigeriaianawiki12tt..ng
tabularlydeftabular.lywhois.lyLibyan Arab Jamahiriyaianawiki9tt..ly
tabulasmaragdinadeftabulasmaragdi.nawhois.naNamibiaianawiki16tt..na
tabulatesdeftabulat.eswhois.esSpainianawiki9tt..es
tabulatingdeftabulati.ngwhois.ngNigeriaianawiki10tt..ng
tabulideftabu.liwhois.liLiechtensteinianawiki6tt..li
tabulisdeftabul.iswhois.isIcelandianawiki7tt..is
tabusdeftab.uswhois.usUnited Statesianawiki5tt..us
tacdeft.acwhois.acAscension Islandianawiki3tt..ac
tacamahacdeftacamah.acwhois.acAscension Islandianawiki9tt..ac
tacamahacadeftacamaha.cawhois.caCanadaianawiki10tt..ca
tacamahackdeftacamaha.ckwhois.ckCook Islandsianawiki10tt..ck
tacandeftac.anwhois.anNetherlands Antillesianawiki5tt..an
tacanadeftaca.nawhois.naNamibiaianawiki6tt..na
tacanandeftacan.anwhois.anNetherlands Antillesianawiki7tt..an
taccadeftac.cawhois.caCanadaianawiki5tt..ca
taccaarrowrootdeftaccaarrow.rootwhois.rootRoot Server InfrastructureN/Awiki14tt..root
taccaceaedeftaccace.aewhois.aeUnited Arab Emiratesianawiki9tt..ae
taccaceousdeftaccaceo.uswhois.usUnited Statesianawiki10tt..us
taccsdeftac.cswhois.csSerbia and Montenegroianawiki5tt..cs
tacesdeftac.eswhois.esSpainianawiki5tt..es
tacetdeftac.etwhois.etEthiopiaianawiki5tt..et
tachdefta.chwhois.chSwitzerlandianawiki4tt..ch
tachardiinaedeftachardiin.aewhois.aeUnited Arab Emiratesianawiki12tt..ae
tacheometerdeftacheomet.erwhois.erEritreaianawiki11tt..er
tachesdeftach.eswhois.esSpainianawiki6tt..es
tacheturedeftachetu.rewhois.reReunion Islandianawiki9tt..re
tachibanadeftachiba.nawhois.naNamibiaianawiki9tt..na
tachinadeftachi.nawhois.naNamibiaianawiki7tt..na
tachinaflydeftachinaf.lywhois.lyLibyan Arab Jamahiriyaianawiki10tt..ly
tachinariandeftachinari.anwhois.anNetherlands Antillesianawiki11tt..an
tachingdeftachi.ngwhois.ngNigeriaianawiki7tt..ng
tachiniddeftachin.idwhois.idIndonesiaianawiki8tt..id
tachinidaedeftachinid.aewhois.aeUnited Arab Emiratesianawiki10tt..ae
tachismdeftachi.smwhois.smSan Marinoianawiki7tt..sm
tachismsdeftachis.mswhois.msMontserratianawiki8tt..ms
tachistdeftachi.stwhois.stSao Tome and Principeianawiki7tt..st
tachistesdeftachist.eswhois.esSpainianawiki9tt..es
tachistoscopedeftachistosco.pewhois.pePeruianawiki13tt..pe
tachistoscopicallydeftachistoscopical.lywhois.lyLibyan Arab Jamahiriyaianawiki18tt..ly
tachogramdeftachogr.amwhois.amArmeniaianawiki9tt..am
tachographdeftachogra.phwhois.phPhilippinesianawiki10tt..ph
tachometerdeftachomet.erwhois.erEritreaianawiki10tt..er
tachoscopedeftachosco.pewhois.pePeruianawiki10tt..pe
tachyauxesisdeftachyauxes.iswhois.isIcelandianawiki12tt..is
tachycardiacdeftachycardi.acwhois.acAscension Islandianawiki12tt..ac
tachycasedeftachyca.sewhois.seSwedenianawiki9tt..se
tachygenesisdeftachygenes.iswhois.isIcelandianawiki12tt..is
tachyglossaldeftachygloss.alwhois.alAlbaniaianawiki12tt..al
tachyglossidaedeftachyglossid.aewhois.aeUnited Arab Emiratesianawiki14tt..ae
tachyglossusdeftachygloss.uswhois.usUnited Statesianawiki12tt..us
tachygraphdeftachygra.phwhois.phPhilippinesianawiki10tt..ph
tachygrapherdeftachygraph.erwhois.erEritreaianawiki12tt..er
tachygraphicaldeftachygraphic.alwhois.alAlbaniaianawiki14tt..al
tachygraphicallydeftachygraphical.lywhois.lyLibyan Arab Jamahiriyaianawiki16tt..ly
tachygraphistdeftachygraphi.stwhois.stSao Tome and Principeianawiki13tt..st
tachygraphometerdeftachygraphomet.erwhois.erEritreaianawiki16tt..er
tachymeterdeftachymet.erwhois.erEritreaianawiki10tt..er
tachyphasiadeftachyph.asiawhois.asiaDotAsia OrganizationN/Awiki11tt..asia
tachyphrasiadeftachyphr.asiawhois.asiaDotAsia OrganizationN/Awiki12tt..asia
tachyphylaxisdeftachyphylax.iswhois.isIcelandianawiki13tt..is
tachyscopedeftachysco.pewhois.pePeruianawiki10tt..pe
tachyseismdeftachysei.smwhois.smSan Marinoianawiki10tt..sm
tachytelydeftachyte.lywhois.lyLibyan Arab Jamahiriyaianawiki9tt..ly
tachythanatousdeftachythanato.uswhois.usUnited Statesianawiki14tt..us
tachytomydeftachyto.mywhois.myMalaysiaianawiki9tt..my
tachytypedeftachyty.pewhois.pePeruianawiki9tt..pe
tacitdeftac.itwhois.itItalyianawiki5tt..it
taciteandeftacite.anwhois.anNetherlands Antillesianawiki8tt..an
tacitlydeftacit.lywhois.lyLibyan Arab Jamahiriyaianawiki7tt..ly
tacitnessesdeftacitness.eswhois.esSpainianawiki11tt..es
taciturnistdeftaciturni.stwhois.stSao Tome and Principeianawiki11tt..st
taciturnitiesdeftaciturniti.eswhois.esSpainianawiki13tt..es
taciturnlydeftaciturn.lywhois.lyLibyan Arab Jamahiriyaianawiki10tt..ly
tacitusdeftacit.uswhois.usUnited Statesianawiki7tt..us
tackdefta.ckwhois.ckCook Islandsianawiki4tt..ck
tackbumpkindeftackbumpk.inwhois.inIndiaianawiki11tt..in
tackerdeftack.erwhois.erEritreaianawiki6tt..er
tacketdeftack.etwhois.etEthiopiaianawiki6tt..et
tackhammerdeftackhamm.erwhois.erEritreaianawiki10tt..er
tackierdeftacki.erwhois.erEritreaianawiki7tt..er
tackiesdeftacki.eswhois.esSpainianawiki7tt..es
tackiestdeftackie.stwhois.stSao Tome and Principeianawiki8tt..st
tackifierdeftackifi.erwhois.erEritreaianawiki9tt..er
tackifiesdeftackifi.eswhois.esSpainianawiki9tt..es
tackifyingdeftackifyi.ngwhois.ngNigeriaianawiki10tt..ng
tackilydeftacki.lywhois.lyLibyan Arab Jamahiriyaianawiki7tt..ly
tackingdeftacki.ngwhois.ngNigeriaianawiki7tt..ng
tackinglydeftacking.lywhois.lyLibyan Arab Jamahiriyaianawiki9tt..ly
tackleblockdeftackleblo.ckwhois.ckCook Islandsianawiki11tt..ck
tacklehousedeftacklehou.sewhois.seSwedenianawiki11tt..se
tacklemandeftacklem.anwhois.anNetherlands Antillesianawiki9tt..an
tacklepostdeftackle.postwhois.postPostalN/Awiki10tt..post
tacklepostdeftacklepo.stwhois.stSao Tome and Principeianawiki10tt..st
tacklerdeftackl.erwhois.erEritreaianawiki7tt..er
tacklesdeftackl.eswhois.esSpainianawiki7tt..es
tacklinedeftackli.newhois.neNigerianawiki8tt..ne
tacklingdeftackli.ngwhois.ngNigeriaianawiki8tt..ng
tacklingsdeftacklin.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki9tt..gs
tackpindeftackp.inwhois.inIndiaianawiki7tt..in
tackrivetdeftackriv.etwhois.etEthiopiaianawiki9tt..et
tackroomdeftackro.omwhois.omOmanianawiki8tt..om
tacksmandeftacksm.anwhois.anNetherlands Antillesianawiki8tt..an
tacktogetherdeftacktogeth.erwhois.erEritreaianawiki12tt..er
tackwelderdeftackweld.erwhois.erEritreaianawiki10tt..er
tackweldingdeftackweldi.ngwhois.ngNigeriaianawiki11tt..ng
tackydeftac.kywhois.kyCayman Islandsianawiki5tt..ky
taclobandeftaclob.anwhois.anNetherlands Antillesianawiki8tt..an
taclocusdeftacloc.uswhois.usUnited Statesianawiki8tt..us
tacmahackdeftacmaha.ckwhois.ckCook Islandsianawiki9tt..ck
tacnadeftac.nawhois.naNamibiaianawiki5tt..na
tacnaaricadeftacnaari.cawhois.caCanadaianawiki10tt..ca
tacnodedeftacno.dewhois.deGermanyianawiki7tt..de
tacnoderaredeftacnodera.rewhois.reReunion Islandianawiki11tt..re
tacnodesdeftacnod.eswhois.esSpainianawiki8tt..es
tacodefta.cowhois.coColombiaianawiki4tt..co
tacomadeftaco.mawhois.maMoroccoianawiki6tt..ma
tacomandeftacom.anwhois.anNetherlands Antillesianawiki7tt..an
taconiandeftaconi.anwhois.anNetherlands Antillesianawiki8tt..an
taconitesdeftaconit.eswhois.esSpainianawiki9tt..es
tacpointdeftacpo.intwhois.intInternational Organizationsianawiki8tt..int
tacquetdeftacqu.etwhois.etEthiopiaianawiki7tt..et
tacsodeftac.sowhois.soSomaliaianawiki5tt..so
tactfullydeftactful.lywhois.lyLibyan Arab Jamahiriyaianawiki9tt..ly
tacticaldeftactic.alwhois.alAlbaniaianawiki8tt..al
tacticalbombingdeftacticalbombi.ngwhois.ngNigeriaianawiki15tt..ng
tacticallydeftactical.lywhois.lyLibyan Arab Jamahiriyaianawiki10tt..ly
tacticalplandeftacticalpl.anwhois.anNetherlands Antillesianawiki12tt..an
tacticalsupportbomberdeftacticalsupportbomb.erwhois.erEritreaianawiki21tt..er
tacticalunitdeftacticalun.itwhois.itItalyianawiki12tt..it
tacticiandeftactici.anwhois.anNetherlands Antillesianawiki9tt..an
tacticsdeftacti.cswhois.csSerbia and Montenegroianawiki7tt..cs
tactilehairdeftactileha.irwhois.irIran, Islamic Republic ofianawiki11tt..ir
tactilelydeftactile.lywhois.lyLibyan Arab Jamahiriyaianawiki9tt..ly
tactileorgandeftactileorg.anwhois.anNetherlands Antillesianawiki12tt..an
tactilesensedeftactilesen.sewhois.seSwedenianawiki12tt..se
tactilistdeftactili.stwhois.stSao Tome and Principeianawiki9tt..st
tactilitiesdeftactiliti.eswhois.esSpainianawiki11tt..es
tactilogicaldeftactilogic.alwhois.alAlbaniaianawiki12tt..al
tactivedeftacti.vewhois.veVenezuelaianawiki7tt..ve
tactlesslydeftactless.lywhois.lyLibyan Arab Jamahiriyaianawiki10tt..ly
tactoiddeftacto.idwhois.idIndonesiaianawiki7tt..id
tactometerdeftactomet.erwhois.erEritreaianawiki10tt..er
tactualdeftactu.alwhois.alAlbaniaianawiki7tt..al
tactualistdeftactuali.stwhois.stSao Tome and Principeianawiki10tt..st
tactuallydeftactual.lywhois.lyLibyan Arab Jamahiriyaianawiki9tt..ly
tactusdeftact.uswhois.usUnited Statesianawiki6tt..us
tacuacinedeftacuaci.newhois.neNigerianawiki9tt..ne
tacullideftacul.liwhois.liLiechtensteinianawiki7tt..li
tacydefta.cywhois.cyCyprusianawiki4tt..cy
tacyedeftac.yewhois.yeYemenianawiki5tt..ye
taddeft.adwhois.adAndorraianawiki3tt..ad
tadbhavadeftadbha.vawhois.vaHoly See (Vatican City State)ianawiki8tt..va
tadddefta.ddwhois.ddGerman Democratic RepublicN/Awiki4tt..dd
taddeuszdeftaddeu.szwhois.szSwazilandianawiki8tt..sz
tadedefta.dewhois.deGermanyianawiki4tt..de
tadeasdeftade.aswhois.asAmerican Samoaianawiki6tt..as
tademadeftade.mawhois.maMoroccoianawiki6tt..ma
tadesdeftad.eswhois.esSpainianawiki5tt..es
tadeusdeftade.uswhois.usUnited Statesianawiki6tt..us
tadichdeftadi.chwhois.chSwitzerlandianawiki6tt..ch
tadiodeftad.iowhois.ioBritish Indian Ocean Territoryianawiki5tt..io
tadousacdeftadous.acwhois.acAscension Islandianawiki8tt..ac
tadpoledomdeftadpoled.omwhois.omOmanianawiki10tt..om
tadpolefishdeftadpolefi.shwhois.shSaint Helenaianawiki11tt..sh
tadpolelikedeftadpoleli.kewhois.keKenyaianawiki11tt..ke
tadpolesdeftadpol.eswhois.esSpainianawiki8tt..es
tadpolismdeftadpoli.smwhois.smSan Marinoianawiki9tt..sm
tadzhikideftadzhi.kiwhois.kiKiribatiianawiki8tt..ki
tadzhikistandeftadzhikist.anwhois.anNetherlands Antillesianawiki12tt..an
taedeft.aewhois.aeUnited Arab Emiratesianawiki3tt..ae
taediumvitaedeftaediumvit.aewhois.aeUnited Arab Emiratesianawiki12tt..ae
taegudeftae.guwhois.guGuamianawiki5tt..gu
taekwandodeftaekwan.dowhois.doDominican Republicianawiki9tt..do
taelsdeftae.lswhois.lsLesothoianawiki5tt..ls
taeniacidaldeftaeniacid.alwhois.alAlbaniaianawiki11tt..al
taeniacidedeftaeniaci.dewhois.deGermanyianawiki10tt..de
taeniaedeftaeni.aewhois.aeUnited Arab Emiratesianawiki7tt..ae
taeniafugedeftaeniafu.gewhois.geGeorgiaianawiki10tt..ge
taenialdeftaeni.alwhois.alAlbaniaianawiki7tt..al
taeniandeftaeni.anwhois.anNetherlands Antillesianawiki7tt..an
taeniasdeftaeni.aswhois.asAmerican Samoaianawiki7tt..as
taeniasisdeftaenias.iswhois.isIcelandianawiki9tt..is
taenicidedeftaenici.dewhois.deGermanyianawiki9tt..de
taenidialdeftaenidi.alwhois.alAlbaniaianawiki9tt..al
taenidiumdeftaenidi.umwhois.umUnited States Minor Outlying Islandsianawiki9tt..um
taenifugedeftaenifu.gewhois.geGeorgiaianawiki9tt..ge
taeniodeftaen.iowhois.ioBritish Indian Ocean Territoryianawiki6tt..io
taeniodontidaedeftaeniodontid.aewhois.aeUnited Arab Emiratesianawiki14tt..ae
taenioglossadeftaenioglos.sawhois.saSaudi Arabiaianawiki12tt..sa
taenioiddeftaenio.idwhois.idIndonesiaianawiki8tt..id
taenioladeftaenio.lawhois.laLao People's Democratic Republicianawiki8tt..la
taeniosomousdeftaeniosomo.uswhois.usUnited Statesianawiki12tt..us
taennindeftaenn.inwhois.inIndiaianawiki7tt..in
taffarelsdeftaffare.lswhois.lsLesothoianawiki9tt..ls
tafferelsdeftaffere.lswhois.lsLesothoianawiki9tt..ls
taffetasdeftaffet.aswhois.asAmerican Samoaianawiki8tt..as
taffetaweavedeftaffetawea.vewhois.veVenezuelaianawiki12tt..ve
taffiasdeftaffi.aswhois.asAmerican Samoaianawiki7tt..as
taffiesdeftaffi.eswhois.esSpainianawiki7tt..es
taffraildeftaffra.ilwhois.ilIsraelianawiki8tt..il
taffrailsdeftaffrai.lswhois.lsLesothoianawiki9tt..ls
taffylikedeftaffyli.kewhois.keKenyaianawiki9tt..ke
taffymakerdeftaffymak.erwhois.erEritreaianawiki10tt..er
taffymakingdeftaffymaki.ngwhois.ngNigeriaianawiki11tt..ng
taffywisedeftaffywi.sewhois.seSwedenianawiki9tt..se
tafiasdeftafi.aswhois.asAmerican Samoaianawiki6tt..as
tafilaletdeftafilal.etwhois.etEthiopiaianawiki9tt..et
tafileltdeftafile.ltwhois.ltLithuaniaianawiki8tt..lt
tafinaghdeftafina.ghwhois.ghGhanaianawiki8tt..gh
tagdeft.agwhois.agAntigua and Barbudaianawiki3tt..ag
tagabilisdeftagabil.iswhois.isIcelandianawiki9tt..is
tagaddresserdeftagaddress.erwhois.erEritreaianawiki12tt..er
tagaddressingdeftagaddressi.ngwhois.ngNigeriaianawiki13tt..ng
tagaffixingdeftagaffixi.ngwhois.ngNigeriaianawiki11tt..ng
tagafterdeftagaft.erwhois.erEritreaianawiki8tt..er
tagaldeftag.alwhois.alAlbaniaianawiki5tt..al
tagaladeftaga.lawhois.laLao People's Democratic Republicianawiki6tt..la
tagalderdeftagald.erwhois.erEritreaianawiki8tt..er
tagalogsdeftagalo.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki8tt..gs
tagalongdeftagalo.ngwhois.ngNigeriaianawiki8tt..ng
tagalongsdeftagalon.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki9tt..gs
tagandragdeftagandr.agwhois.agAntigua and Barbudaianawiki9tt..ag
tagassudeftagas.suwhois.suSoviet UnionN/Awiki7tt..su
tagassuidaedeftagassuid.aewhois.aeUnited Arab Emiratesianawiki11tt..ae
tagatosedeftagato.sewhois.seSwedenianawiki8tt..se
tagbanuadeftagban.uawhois.uaUkraineianawiki8tt..ua
tagboatdeftagbo.atwhois.atAustriaianawiki7tt..at
tagdatingdeftagdati.ngwhois.ngNigeriaianawiki9tt..ng
tageerlanderdeftageerland.erwhois.erEritreaianawiki12tt..er
tagerdeftag.erwhois.erEritreaianawiki5tt..er
tagetesdeftaget.eswhois.esSpainianawiki7tt..es
tagetonedeftageto.newhois.neNigerianawiki8tt..ne
taggedatomdeftaggedat.omwhois.omOmanianawiki10tt..om
taggerdeftagg.erwhois.erEritreaianawiki6tt..er
taggingdeftaggi.ngwhois.ngNigeriaianawiki7tt..ng
taggydeftag.gywhois.gyGuyanaianawiki5tt..gy
tagishdeftagi.shwhois.shSaint Helenaianawiki6tt..sh
tagletdeftagl.etwhois.etEthiopiaianawiki6tt..et
tagliacotiandeftagliacoti.anwhois.anNetherlands Antillesianawiki12tt..an
tagliacozziandeftagliacozzi.anwhois.anNetherlands Antillesianawiki13tt..an
tagliarinideftagliari.niwhois.niNicaraguaianawiki10tt..ni
taglikedeftagli.kewhois.keKenyaianawiki7tt..ke
taglinedeftagli.newhois.neNigerianawiki7tt..ne
taglionideftaglio.niwhois.niNicaraguaianawiki8tt..ni
taglockdeftaglo.ckwhois.ckCook Islandsianawiki7tt..ck
tagmarkingdeftagmarki.ngwhois.ngNigeriaianawiki10tt..ng
tagmemesdeftagmem.eswhois.esSpainianawiki8tt..es
tagmemicanalysisdeftagmemicanalys.iswhois.isIcelandianawiki16tt..is
tagmemicsdeftagmemi.cswhois.csSerbia and Montenegroianawiki9tt..cs
tagoredeftago.rewhois.reReunion Islandianawiki6tt..re
tagragdeftagr.agwhois.agAntigua and Barbudaianawiki6tt..ag
tagragandbobtaildeftagragandbobta.ilwhois.ilIsraelianawiki16tt..il
tagragsdeftagra.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki7tt..gs
tagsdefta.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki4tt..gs
tagsoredeftagso.rewhois.reReunion Islandianawiki7tt..re
tagsterdeftagst.erwhois.erEritreaianawiki7tt..er
tagstringingdeftagstringi.ngwhois.ngNigeriaianawiki12tt..ng
tagtaildeftagta.ilwhois.ilIsraelianawiki7tt..il
taguadeftag.uawhois.uaUkraineianawiki5tt..ua
taguandeftagu.anwhois.anNetherlands Antillesianawiki6tt..an
taguladeftagu.lawhois.laLao People's Democratic Republicianawiki6tt..la
tagusdeftag.uswhois.usUnited Statesianawiki5tt..us
tahacarimdeftahacar.imwhois.imIsle of Manianawiki9tt..im
tahalideftaha.liwhois.liLiechtensteinianawiki6tt..li
tahardeftah.arwhois.arArgentinaianawiki5tt..ar
tahildeftah.ilwhois.ilIsraelianawiki5tt..il
tahindeftah.inwhois.inIndiaianawiki5tt..in
tahinadeftahi.nawhois.naNamibiaianawiki6tt..na
tahinideftahi.niwhois.niNicaraguaianawiki6tt..ni
tahinisdeftahin.iswhois.isIcelandianawiki7tt..is
tahitiandeftahiti.anwhois.anNetherlands Antillesianawiki8tt..an
tahkhanadeftahkha.nawhois.naNamibiaianawiki8tt..na
tahltandeftahlt.anwhois.anNetherlands Antillesianawiki7tt..an
tahmoshdeftahmo.shwhois.shSaint Helenaianawiki7tt..sh
tahonadeftaho.nawhois.naNamibiaianawiki6tt..na
tahrdefta.hrwhois.hrCroatia/Hrvatskaianawiki4tt..hr
tahseeldardeftahseeld.arwhois.arArgentinaianawiki10tt..ar
tahsildeftahs.ilwhois.ilIsraelianawiki6tt..il
tahsildardeftahsild.arwhois.arArgentinaianawiki9tt..ar
tahsilsdeftahsi.lswhois.lsLesothoianawiki7tt..ls
tahuadeftah.uawhois.uaUkraineianawiki5tt..ua
taideft.aiwhois.aiAnguillaianawiki3tt..ai
taibandeftaib.anwhois.anNetherlands Antillesianawiki6tt..an
taichdeftai.chwhois.chSwitzerlandianawiki5tt..ch
taichichuandeftaichichu.anwhois.anNetherlands Antillesianawiki11tt..an
taichinesedeftaichine.sewhois.seSwedenianawiki10tt..se
taichudeftaic.huwhois.huHungaryianawiki6tt..hu
taichungdeftaichu.ngwhois.ngNigeriaianawiki8tt..ng
taigadeftai.gawhois.gaGabonianawiki5tt..ga
taigasdeftaig.aswhois.asAmerican Samoaianawiki6tt..as
taiglachdeftaigla.chwhois.chSwitzerlandianawiki8tt..ch
taikhanadeftaikha.nawhois.naNamibiaianawiki8tt..na
taikyudeftaik.yuwhois.yuYugoslaviaianawiki6tt..yu
taildefta.ilwhois.ilIsraelianawiki4tt..il
tailagedeftaila.gewhois.geGeorgiaianawiki7tt..ge
tailbackdeftailba.ckwhois.ckCook Islandsianawiki8tt..ck
tailbeamdeftailbe.amwhois.amArmeniaianawiki8tt..am
tailblockdeftailblo.ckwhois.ckCook Islandsianawiki9tt..ck
tailbonedeftailbo.newhois.neNigerianawiki8tt..ne
tailbonesdeftailbon.eswhois.esSpainianawiki9tt..es
tailboomdeftailbo.omwhois.omOmanianawiki8tt..om
tailchasingdeftailchasi.ngwhois.ngNigeriaianawiki11tt..ng
tailcoatdeftailco.atwhois.atAustriaianawiki8tt..at
tailconedeftailco.newhois.neNigerianawiki8tt..ne
tailedsonnetdeftailedsonn.etwhois.etEthiopiaianawiki12tt..et
tailedsonnetdeftailedson.netwhois.netNetworksianawiki12tt..net
tailedtoaddeftailedto.adwhois.adAndorraianawiki10tt..ad
tailenderdeftailend.erwhois.erEritreaianawiki9tt..er
tailerdeftail.erwhois.erEritreaianawiki6tt..er
tailetdeftail.etwhois.etEthiopiaianawiki6tt..et
tailfandeftailf.anwhois.anNetherlands Antillesianawiki7tt..an
tailfindeftailf.inwhois.inIndiaianawiki7tt..in
tailfirstdeftailfir.stwhois.stSao Tome and Principeianawiki9tt..st
tailflowerdeftailflow.erwhois.erEritreaianawiki10tt..er
tailflydeftailf.lywhois.lyLibyan Arab Jamahiriyaianawiki7tt..ly
tailforemostdeftailforemo.stwhois.stSao Tome and Principeianawiki12tt..st
tailgaterdeftailgat.erwhois.erEritreaianawiki9tt..er
tailgatesdeftailgat.eswhois.esSpainianawiki9tt..es
tailgatingdeftailgati.ngwhois.ngNigeriaianawiki10tt..ng
tailgedeftail.gewhois.geGeorgiaianawiki6tt..ge
tailglidedeftailgli.dewhois.deGermanyianawiki9tt..de
tailgrapedeftailgra.pewhois.pePeruianawiki9tt..pe
tailgunnerdeftailgunn.erwhois.erEritreaianawiki10tt..er
tailheaddeftailhe.adwhois.adAndorraianawiki8tt..ad
tailhighlandingdeftailhighlandi.ngwhois.ngNigeriaianawiki15tt..ng
tailhousedeftailhou.sewhois.seSwedenianawiki9tt..se
tailingdeftaili.ngwhois.ngNigeriaianawiki7tt..ng
tailingsdeftailin.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki8tt..gs
tailingsaugerdeftailingsaug.erwhois.erEritreaianawiki13tt..er
tailjoistdeftailjoi.stwhois.stSao Tome and Principeianawiki9tt..st
taillampdeftailla.mpwhois.mpNorthern Mariana Islandsianawiki8tt..mp
taillesdeftaill.eswhois.esSpainianawiki7tt..es
taillessairplanedeftaillessairpla.newhois.neNigerianawiki16tt..ne
taillessjetdeftaillessj.etwhois.etEthiopiaianawiki11tt..et
taillesslydeftailless.lywhois.lyLibyan Arab Jamahiriyaianawiki10tt..ly
tailliedeftaill.iewhois.ieIrelandianawiki7tt..ie
taillightdeftaillig.htwhois.htHaitiianawiki9tt..ht
taillikedeftailli.kewhois.keKenyaianawiki8tt..ke
taillockdeftaillo.ckwhois.ckCook Islandsianawiki8tt..ck
tailloirdeftaillo.irwhois.irIran, Islamic Republic ofianawiki8tt..ir
taillowlandingdeftaillowlandi.ngwhois.ngNigeriaianawiki14tt..ng
tailoragedeftailora.gewhois.geGeorgiaianawiki9tt..ge
tailorbuiltdeftailorbui.ltwhois.ltLithuaniaianawiki11tt..lt
tailordomdeftailord.omwhois.omOmanianawiki9tt..om
tailoredsuitdeftailoredsu.itwhois.itItalyianawiki12tt..it
tailoringdeftailori.ngwhois.ngNigeriaianawiki9tt..ng
tailorismdeftailori.smwhois.smSan Marinoianawiki9tt..sm
tailorlikedeftailorli.kewhois.keKenyaianawiki10tt..ke
tailorlydeftailor.lywhois.lyLibyan Arab Jamahiriyaianawiki8tt..ly
tailormadedeftailorma.dewhois.deGermanyianawiki10tt..de
tailormadesdeftailormad.eswhois.esSpainianawiki11tt..es
tailormakedeftailorma.kewhois.keKenyaianawiki10tt..ke
tailormakingdeftailormaki.ngwhois.ngNigeriaianawiki12tt..ng
tailormandeftailorm.anwhois.anNetherlands Antillesianawiki9tt..an
tailorschalkdeftailorscha.lkwhois.lkSri Lankaianawiki12tt..lk
tailorstackdeftailorsta.ckwhois.ckCook Islandsianawiki11tt..ck
tailorwarblerdeftailorwarbl.erwhois.erEritreaianawiki13tt..er
tailorwisedeftailorwi.sewhois.seSwedenianawiki10tt..se
tailpindeftailp.inwhois.inIndiaianawiki7tt..in
tailpipedeftailpi.pewhois.pePeruianawiki8tt..pe
tailpipeburnerdeftailpipeburn.erwhois.erEritreaianawiki14tt..er
tailpipesdeftailpip.eswhois.esSpainianawiki9tt..es
tailpitdeftailp.itwhois.itItalyianawiki7tt..it
tailplanedeftailpla.newhois.neNigerianawiki9tt..ne
tailprintdeftailpr.intwhois.intInternational Organizationsianawiki9tt..int
tailracesdeftailrac.eswhois.esSpainianawiki9tt..es
tailropedeftailro.pewhois.pePeruianawiki8tt..pe
tailsdeftai.lswhois.lsLesothoianawiki5tt..ls
tailsetdeftails.etwhois.etEthiopiaianawiki7tt..et
tailsheetdeftailshe.etwhois.etEthiopiaianawiki9tt..et
tailskiddeftailsk.idwhois.idIndonesiaianawiki8tt..id
tailskiddeftails.kidwhois.kidChildrenN/Awiki8tt..kid
tailslidedeftailsli.dewhois.deGermanyianawiki9tt..de
tailsmandeftailsm.anwhois.anNetherlands Antillesianawiki8tt..an
tailspindeftailsp.inwhois.inIndiaianawiki8tt..in
tailstingerdeftailsting.erwhois.erEritreaianawiki11tt..er
tailstockdeftailsto.ckwhois.ckCook Islandsianawiki9tt..ck
tailswitchingdeftailswitchi.ngwhois.ngNigeriaianawiki13tt..ng
tailteangamesdeftailteangam.eswhois.esSpainianawiki13tt..es
tailunitdeftailun.itwhois.itItalyianawiki8tt..it
tailwaggingdeftailwaggi.ngwhois.ngNigeriaianawiki11tt..ng
tailwaterdeftailwat.erwhois.erEritreaianawiki9tt..er
tailwisedeftailwi.sewhois.seSwedenianawiki8tt..se
tailydeftai.lywhois.lyLibyan Arab Jamahiriyaianawiki5tt..ly
tailyedeftail.yewhois.yeYemenianawiki6tt..ye
tailzeedeftailz.eewhois.eeEstoniaianawiki7tt..ee
tailziedeftailz.iewhois.ieIrelandianawiki7tt..ie
taimadeftai.mawhois.maMoroccoianawiki5tt..ma
taimirpeninsuladeftaimirpeninsu.lawhois.laLao People's Democratic Republicianawiki15tt..la
taimyrpeninsuladeftaimyrpeninsu.lawhois.laLao People's Democratic Republicianawiki15tt..la
taindefta.inwhois.inIndiaianawiki4tt..in
tainandeftain.anwhois.anNetherlands Antillesianawiki6tt..an
tainedeftai.newhois.neNigerianawiki5tt..ne
tainodeftai.nowhois.noNorwayianawiki5tt..no
taintdefta.intwhois.intInternational Organizationsianawiki5tt..int
taintfreedeftaintfr.eewhois.eeEstoniaianawiki9tt..ee
taintingdeftainti.ngwhois.ngNigeriaianawiki8tt..ng
taintlesslydeftaintless.lywhois.lyLibyan Arab Jamahiriyaianawiki11tt..ly
tainturedeftaintu.rewhois.reReunion Islandianawiki8tt..re
taipandeftaip.anwhois.anNetherlands Antillesianawiki6tt..an
taipingdeftaipi.ngwhois.ngNigeriaianawiki7tt..ng
tairgedeftair.gewhois.geGeorgiaianawiki6tt..ge
tairgerdeftairg.erwhois.erEritreaianawiki7tt..er
taischdeftais.chwhois.chSwitzerlandianawiki6tt..ch
taisedeftai.sewhois.seSwedenianawiki5tt..se
taishdeftai.shwhois.shSaint Helenaianawiki5tt..sh
taistrildeftaistr.ilwhois.ilIsraelianawiki8tt..il
taitdefta.itwhois.itItalyianawiki4tt..it
taiverdeftaiv.erwhois.erEritreaianawiki6tt..er
taiwandeftaiw.anwhois.anNetherlands Antillesianawiki6tt..an
taiwanesedeftaiwane.sewhois.seSwedenianawiki9tt..se
taiwanhempdeftaiwanhe.mpwhois.mpNorthern Mariana Islandsianawiki10tt..mp
taiwanstraitdeftaiwanstra.itwhois.itItalyianawiki12tt..it
taiyaldeftaiy.alwhois.alAlbaniaianawiki6tt..al
taiyuandeftaiyu.anwhois.anNetherlands Antillesianawiki7tt..an
tajesdeftaj.eswhois.esSpainianawiki5tt..es
tajikideftaji.kiwhois.kiKiribatiianawiki6tt..ki
tajmahaldeftajmah.alwhois.alAlbaniaianawiki8tt..al
tajodefta.jowhois.joJordanianawiki4tt..jo
takahesdeftakah.eswhois.esSpainianawiki7tt..es
takamatsudeftakamat.suwhois.suSoviet UnionN/Awiki9tt..su
takaodeftak.aowhois.aoAngolaianawiki5tt..ao
takardeftak.arwhois.arArgentinaianawiki5tt..ar
takedefta.kewhois.keKenyaianawiki4tt..ke
takeabackdeftakeaba.ckwhois.ckCook Islandsianawiki9tt..ck
takeabackseatdeftakeabackse.atwhois.atAustriaianawiki13tt..at
takeacoursedeftakeacour.sewhois.seSwedenianawiki11tt..se
takeacrackatdeftakeacrack.atwhois.atAustriaianawiki12tt..at
takeadaredeftakeada.rewhois.reReunion Islandianawiki9tt..re
takeadisliketodeftakeadislike.towhois.toTongaianawiki14tt..to
takeadivedeftakeadi.vewhois.veVenezuelaianawiki9tt..ve
takeadroptoomuchdeftakeadroptoomu.chwhois.chSwitzerlandianawiki16tt..ch
takeafancytodeftakeafancy.towhois.toTongaianawiki12tt..to
takeaflierdeftakeafli.erwhois.erEritreaianawiki10tt..er
takeaflightdeftakeaflig.htwhois.htHaitiianawiki11tt..ht
takeaflingatdeftakeafling.atwhois.atAustriaianawiki12tt..at
takeafterdeftakeaft.erwhois.erEritreaianawiki9tt..er
takeaglanceatdeftakeaglance.atwhois.atAustriaianawiki13tt..at
takeahandindeftakeahand.inwhois.inIndiaianawiki11tt..in
takeaheaderdeftakeahead.erwhois.erEritreaianawiki11tt..er
takeaheadingdeftakeaheadi.ngwhois.ngNigeriaianawiki12tt..ng
takeaimdeftakea.imwhois.imIsle of Manianawiki7tt..im
takeaimatdeftakeaim.atwhois.atAustriaianawiki9tt..at
takeajoyridedeftakeajoyri.dewhois.deGermanyianawiki12tt..de
takealikingtodeftakealiking.towhois.toTongaianawiki13tt..to
takealivelyinterestdeftakealivelyintere.stwhois.stSao Tome and Principeianawiki19tt..st
takealongdeftakealo.ngwhois.ngNigeriaianawiki9tt..ng
takealookatdeftakealook.atwhois.atAustriaianawiki11tt..at
takeanactivepartindeftakeanactivepart.inwhois.inIndiaianawiki18tt..in
takeanapproachtodeftakeanapproach.towhois.toTongaianawiki16tt..to
takeanassumednamedeftakeanassumed.namewhois.namePersonal Namesianawiki17tt..name
takeanattitudedeftakeanattitu.dewhois.deGermanyianawiki14tt..de
takeanaversiontodeftakeanaversion.towhois.toTongaianawiki16tt..to
takeanddodeftakeand.dowhois.doDominican Republicianawiki9tt..do
takeaninterestdeftakeanintere.stwhois.stSao Tome and Principeianawiki14tt..st
takeaninterestindeftakeaninterest.inwhois.inIndiaianawiki16tt..in
takeanoverdosedeftakeanoverdo.sewhois.seSwedenianawiki14tt..se
takeapercentagedeftakeapercenta.gewhois.geGeorgiaianawiki15tt..ge
takeaphotographdeftakeaphotogra.phwhois.phPhilippinesianawiki15tt..ph
takeapicturedeftakeapictu.rewhois.reReunion Islandianawiki12tt..re
takeapokeatdeftakeapoke.atwhois.atAustriaianawiki11tt..at
takeapopatdeftakeapop.atwhois.atAustriaianawiki10tt..at
takeapowderdeftakeapowd.erwhois.erEritreaianawiki11tt..er
takeapremiumdeftakeapremi.umwhois.umUnited States Minor Outlying Islandsianawiki12tt..um
takeapromptdeftakeaprom.ptwhois.ptPortugalianawiki11tt..pt
takeareadingdeftakeareadi.ngwhois.ngNigeriaianawiki12tt..ng
takearestdeftakeare.stwhois.stSao Tome and Principeianawiki9tt..st
takearmsdeftakear.mswhois.msMontserratianawiki8tt..ms
takearubbingdeftakearubbi.ngwhois.ngNigeriaianawiki12tt..ng
takearunoutpowderdeftakearunoutpowd.erwhois.erEritreaianawiki17tt..er
takeasamatterofcoursedeftakeasamatterofcour.sewhois.seSwedenianawiki21tt..se
takeasanexcusedeftakeasanexcu.sewhois.seSwedenianawiki14tt..se
takeasetdeftakeas.etwhois.etEthiopiaianawiki8tt..et
takeasgospeltruthdeftakeasgospeltru.thwhois.thThailandianawiki17tt..th
takeashinetodeftakeashine.towhois.toTongaianawiki12tt..to
takeashitdeftakeash.itwhois.itItalyianawiki9tt..it
takeashotatdeftakeashot.atwhois.atAustriaianawiki11tt..at
takeashyatdeftakeashy.atwhois.atAustriaianawiki10tt..at
takeasidedeftakeasi.dewhois.deGermanyianawiki9tt..de
takeasightdeftakeasig.htwhois.htHaitiianawiki10tt..ht
takeasquintatdeftakeasquint.atwhois.atAustriaianawiki13tt..at
takeastretchdeftakeastret.chwhois.chSwitzerlandianawiki12tt..ch
takeasundaydrivedeftakeasundaydri.vewhois.veVenezuelaianawiki16tt..ve
takeaswingatdeftakeaswing.atwhois.atAustriaianawiki12tt..at
takeaswipeatdeftakeaswipe.atwhois.atAustriaianawiki12tt..at
takeaturnforthebetterdeftakeaturnforthebett.erwhois.erEritreaianawiki21tt..er
takeavoyagedeftakeavoya.gewhois.geGeorgiaianawiki11tt..ge
takeawalkdeftakeawa.lkwhois.lkSri Lankaianawiki9tt..lk
takeawayfromdeftakeawayfr.omwhois.omOmanianawiki12tt..om
takeawayyourbreathdeftakeawayyourbrea.thwhois.thThailandianawiki18tt..th
takeawrongturningdeftakeawrongturni.ngwhois.ngNigeriaianawiki17tt..ng
takebackdeftakeba.ckwhois.ckCook Islandsianawiki8tt..ck
takebearingsdeftakebearin.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki12tt..gs
takebeforethejudgedeftakebeforethejud.gewhois.geGeorgiaianawiki18tt..ge
takebirthdeftakebir.thwhois.thThailandianawiki9tt..th
takebyassaultdeftakebyassau.ltwhois.ltLithuaniaianawiki13tt..lt
takebysurprisedeftakebysurpri.sewhois.seSwedenianawiki14tt..se
takebythethroatdeftakebythethro.atwhois.atAustriaianawiki15tt..at
takecaptivedeftakecapti.vewhois.veVenezuelaianawiki11tt..ve
takecaredeftakeca.rewhois.reReunion Islandianawiki8tt..re
takecareofnumberonedeftakecareofnumbero.newhois.neNigerianawiki19tt..ne
takecenterstagedeftakecentersta.gewhois.geGeorgiaianawiki15tt..ge
takechancesdeftakechanc.eswhois.esSpainianawiki11tt..es
takechargedeftakechar.gewhois.geGeorgiaianawiki10tt..ge
takechargeguydeftakechargeg.uywhois.uyUruguayianawiki13tt..uy
takecounselwithdeftakecounselwi.thwhois.thThailandianawiki15tt..th
takecouragedeftakecoura.gewhois.geGeorgiaianawiki11tt..ge
takecoverdeftakecov.erwhois.erEritreaianawiki9tt..er
takecoverunderdeftakecoverund.erwhois.erEritreaianawiki14tt..er
takecreditdeftakecred.itwhois.itItalyianawiki10tt..it
takedeadaimatdeftakedeadaim.atwhois.atAustriaianawiki13tt..at
takedelightindeftakedelight.inwhois.inIndiaianawiki13tt..in
takedoingdeftakedoi.ngwhois.ngNigeriaianawiki9tt..ng
takedownapegdeftakedownap.egwhois.egEgyptianawiki12tt..eg
takeexceptiontodeftakeexception.towhois.toTongaianawiki15tt..to
takefiredeftakefi.rewhois.reReunion Islandianawiki8tt..re
takefivedeftakefi.vewhois.veVenezuelaianawiki8tt..ve
takeflightdeftakeflig.htwhois.htHaitiianawiki10tt..ht
takeforaridedeftakeforari.dewhois.deGermanyianawiki12tt..de
takeforasuckerdeftakeforasuck.erwhois.erEritreaianawiki14tt..er
takeforbetterorforworsedeftakeforbetterorforwor.sewhois.seSwedenianawiki23tt..se
takefrenchleavedeftakefrenchlea.vewhois.veVenezuelaianawiki15tt..ve
takefrightdeftakefrig.htwhois.htHaitiianawiki10tt..ht
takefromdeftakefr.omwhois.omOmanianawiki8tt..om
takegoodcaredeftakegoodca.rewhois.reReunion Islandianawiki12tt..re
takeheedatyourperildeftakeheedatyourper.ilwhois.ilIsraelianawiki19tt..il
takeholdofonedeftakeholdofo.newhois.neNigerianawiki13tt..ne
takehorsedeftakehor.sewhois.seSwedenianawiki9tt..se
takeindeftake.inwhois.inIndiaianawiki6tt..in
takeinexchangedeftakeinexchan.gewhois.geGeorgiaianawiki14tt..ge
takeingdeftakei.ngwhois.ngNigeriaianawiki7tt..ng
takeinsaildeftakeinsa.ilwhois.ilIsraelianawiki10tt..il
takeintocampdeftakeintoca.mpwhois.mpNorthern Mariana Islandsianawiki12tt..mp
takeintoyourheaddeftakeintoyourhe.adwhois.adAndorraianawiki16tt..ad
takeinvaindeftakeinva.inwhois.inIndiaianawiki10tt..in
takeinyourstridedeftakeinyourstri.dewhois.deGermanyianawiki16tt..de
takeissuewithdeftakeissuewi.thwhois.thThailandianawiki13tt..th
takeitdeftake.itwhois.itItalyianawiki6tt..it
takeiteasydeftakeitea.sywhois.sySyrian Arab Republicianawiki10tt..sy
takeitintoyourheaddeftakeitintoyourhe.adwhois.adAndorraianawiki18tt..ad
takeitinyourstridedeftakeitinyourstri.dewhois.deGermanyianawiki18tt..de
takeitlikeamandeftakeitlikeam.anwhois.anNetherlands Antillesianawiki14tt..an
takeitonthechindeftakeitonthech.inwhois.inIndiaianawiki15tt..in
takeitonthelamdeftakeitonthel.amwhois.amArmeniaianawiki14tt..am
takeitorleaveitdeftakeitorleave.itwhois.itItalyianawiki15tt..it
takeitoutofyourhidedeftakeitoutofyourhi.dewhois.deGermanyianawiki19tt..de
takeitoutofyourskindeftakeitoutofyoursk.inwhois.inIndiaianawiki19tt..in
takeitsrisedeftakeitsri.sewhois.seSwedenianawiki11tt..se
takeitsrisefromdeftakeitsrisefr.omwhois.omOmanianawiki15tt..om
takeitthatdeftakeitth.atwhois.atAustriaianawiki10tt..at
takekindlytodeftakekindly.towhois.toTongaianawiki12tt..to
takeleavedeftakelea.vewhois.veVenezuelaianawiki9tt..ve
takeleaveofyoursensesdeftakeleaveofyoursens.eswhois.esSpainianawiki21tt..es
takelegalproceedingsagainstdeftakelegalproceedingsagain.stwhois.stSao Tome and Principeianawiki27tt..st
takelibertiesdeftakeliberti.eswhois.esSpainianawiki13tt..es
takelibertieswithdeftakelibertieswi.thwhois.thThailandianawiki17tt..th
takelifeeasydeftakelifeea.sywhois.sySyrian Arab Republicianawiki12tt..sy
takelinedeftakeli.newhois.neNigerianawiki8tt..ne
takelmadeftakel.mawhois.maMoroccoianawiki7tt..ma
takemeasuresdeftakemeasur.eswhois.esSpainianawiki12tt..es
takemedicinedeftakemedici.newhois.neNigerianawiki12tt..ne
takenabackdeftakenaba.ckwhois.ckCook Islandsianawiki10tt..ck
takenarrowviewsdeftakenarrowvie.wswhois.wsWestern Samoaianawiki15tt..ws
takenbysurprisedeftakenbysurpri.sewhois.seSwedenianawiki15tt..se
takenodenialdeftakenodeni.alwhois.alAlbaniaianawiki12tt..al
takenointerestindeftakenointerest.inwhois.inIndiaianawiki16tt..in
takenopartindeftakenopart.inwhois.inIndiaianawiki12tt..in
takenostockindeftakenostock.inwhois.inIndiaianawiki13tt..in
takenunawaresdeftakenunawar.eswhois.esSpainianawiki13tt..es
takenupwithdeftakenupwi.thwhois.thThailandianawiki11tt..th
takenwithdeftakenwi.thwhois.thThailandianawiki9tt..th
takeoathdeftakeoa.thwhois.thThailandianawiki8tt..th
takeoffafterdeftakeoffaft.erwhois.erEritreaianawiki12tt..er
takeoffahighdeftakeoffahi.ghwhois.ghGhanaianawiki12tt..gh
takeoffboosterdeftakeoffboost.erwhois.erEritreaianawiki14tt..er
takeoffensedeftakeoffen.sewhois.seSwedenianawiki11tt..se
takeoffpowerdeftakeoffpow.erwhois.erEritreaianawiki12tt..er
takeofframpdeftakeoffra.mpwhois.mpNorthern Mariana Islandsianawiki11tt..mp
takeoffrocketdeftakeoffrock.etwhois.etEthiopiaianawiki13tt..et
takeoffweightdeftakeoffweig.htwhois.htHaitiianawiki13tt..ht
takeoffyourhattodeftakeoffyourhat.towhois.toTongaianawiki16tt..to
takeoffyourshoesdeftakeoffyoursho.eswhois.esSpainianawiki16tt..es
takeoncreditdeftakeoncred.itwhois.itItalyianawiki12tt..it
takeoneoverdeftakeoneov.erwhois.erEritreaianawiki11tt..er
takeonfaithdeftakeonfai.thwhois.thThailandianawiki11tt..th
takeonoverdeftakeonov.erwhois.erEritreaianawiki10tt..er
takeontrustdeftakeontru.stwhois.stSao Tome and Principeianawiki11tt..st
takeonweightdeftakeonweig.htwhois.htHaitiianawiki12tt..ht
takeorderdeftakeord.erwhois.erEritreaianawiki9tt..er
takeorigindeftakeorig.inwhois.inIndiaianawiki10tt..in
takeoutafterdeftakeoutaft.erwhois.erEritreaianawiki12tt..er
takeoutfromunderwrapsdeftakeoutfromunderwra.pswhois.psPalestinian Territory (Occupied)ianawiki21tt..ps
takeoutofmothballsdeftakeoutofmothbal.lswhois.lsLesothoianawiki18tt..ls
takeoverdeftakeov.erwhois.erEritreaianawiki8tt..er
takepartindeftakepart.inwhois.inIndiaianawiki10tt..in
takepartwithdeftakepartwi.thwhois.thThailandianawiki12tt..th
takepleasureindeftakepleasure.inwhois.inIndiaianawiki14tt..in
takepotluckdeftakepotlu.ckwhois.ckCook Islandsianawiki11tt..ck
takeprideindeftakepride.inwhois.inIndiaianawiki11tt..in
takeprisonerdeftakeprison.erwhois.erEritreaianawiki12tt..er
takerdeftak.erwhois.erEritreaianawiki5tt..er
takerefugedeftakerefu.gewhois.geGeorgiaianawiki10tt..ge
takerefugeindeftakerefuge.inwhois.inIndiaianawiki12tt..in
takeresidenceatdeftakeresidence.atwhois.atAustriaianawiki15tt..at
takerestdeftakere.stwhois.stSao Tome and Principeianawiki8tt..st
takerevengedeftakereven.gewhois.geGeorgiaianawiki11tt..ge
takerindeftaker.inwhois.inIndiaianawiki7tt..in
takerisedeftakeri.sewhois.seSwedenianawiki8tt..se
takerootdeftake.rootwhois.rootRoot Server InfrastructureN/Awiki8tt..root
takesdeftak.eswhois.esSpainianawiki5tt..es
takeshapedeftakesha.pewhois.pePeruianawiki9tt..pe
takeshelterdeftakeshelt.erwhois.erEritreaianawiki11tt..er
takesickdeftakesi.ckwhois.ckCook Islandsianawiki8tt..ck
takesidesdeftakesid.eswhois.esSpainianawiki9tt..es
takesideswithdeftakesideswi.thwhois.thThailandianawiki13tt..th
takesilkdeftakesi.lkwhois.lkSri Lankaianawiki8tt..lk
takesomedoingdeftakesomedoi.ngwhois.ngNigeriaianawiki13tt..ng
takesomethinginyourstridedeftakesomethinginyourstri.dewhois.deGermanyianawiki25tt..de
takesoundingsdeftakesoundin.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki13tt..gs
takestepsdeftakeste.pswhois.psPalestinian Territory (Occupied)ianawiki9tt..ps
takestepsandmeasuresdeftakestepsandmeasur.eswhois.esSpainianawiki20tt..es
takestockdeftakesto.ckwhois.ckCook Islandsianawiki9tt..ck
takestockindeftakestock.inwhois.inIndiaianawiki11tt..in
takethdeftake.thwhois.thThailandianawiki6tt..th
taketheairdeftakethea.irwhois.irIran, Islamic Republic ofianawiki10tt..ir
taketheairlinedeftaketheairli.newhois.neNigerianawiki14tt..ne
taketheattitudedeftaketheattitu.dewhois.deGermanyianawiki15tt..de
taketheaveragedeftaketheavera.gewhois.geGeorgiaianawiki14tt..ge
takethebacktrackdeftakethebacktra.ckwhois.ckCook Islandsianawiki16tt..ck
takethebaitdeftaketheba.itwhois.itItalyianawiki11tt..it
takethebitindeftakethebit.inwhois.inIndiaianawiki12tt..in
takethebitintheteethdeftakethebitinthetee.thwhois.thThailandianawiki20tt..th
takethebitinyourteethdeftakethebitinyourtee.thwhois.thThailandianawiki21tt..th
takethecakedeftaketheca.kewhois.keKenyaianawiki11tt..ke
takethechairdeftakethecha.irwhois.irIran, Islamic Republic ofianawiki12tt..ir
taketheconsequencesdeftaketheconsequenc.eswhois.esSpainianawiki19tt..es
takethecuredeftakethecu.rewhois.reReunion Islandianawiki11tt..re
takethegoodthegodsprovidedeftakethegoodthegodsprovi.dewhois.deGermanyianawiki25tt..de
takethegroundfromunderdeftakethegroundfromund.erwhois.erEritreaianawiki22tt..er
taketheinitiativedeftaketheinitiati.vewhois.veVenezuelaianawiki17tt..ve
taketheleaddeftakethele.adwhois.adAndorraianawiki11tt..ad
takethelordsnameinvaindeftakethelordsnameinva.inwhois.inIndiaianawiki22tt..in
takethemarriagevowsdeftakethemarriagevo.wswhois.wsWestern Samoaianawiki19tt..ws
takethemeandeftaketheme.anwhois.anNetherlands Antillesianawiki11tt..an
takethemeasuredeftakethemeasu.rewhois.reReunion Islandianawiki14tt..re
taketheoffensivedeftaketheoffensi.vewhois.veVenezuelaianawiki16tt..ve
takethepledgedeftakethepled.gewhois.geGeorgiaianawiki13tt..ge
taketheplungedeftaketheplun.gewhois.geGeorgiaianawiki13tt..ge
takethereciprocalcoursedeftakethereciprocalcour.sewhois.seSwedenianawiki23tt..se
taketheriskdeftaketheri.skwhois.skSlovak Republicianawiki11tt..sk
taketheroaddeftakethero.adwhois.adAndorraianawiki11tt..ad
takethestumpdeftakethestu.mpwhois.mpNorthern Mariana Islandsianawiki12tt..mp
takethethronedeftakethethro.newhois.neNigerianawiki13tt..ne
taketheveildeftaketheve.ilwhois.ilIsraelianawiki11tt..il
takethevowsdeftakethevo.wswhois.wsWestern Samoaianawiki11tt..ws
takethewindoutofyoursailsdeftakethewindoutofyoursai.lswhois.lsLesothoianawiki25tt..ls
takethewordsoutofyourmouthdeftakethewordsoutofyourmou.thwhois.thThailandianawiki26tt..th
taketimebytheforelockdeftaketimebytheforelo.ckwhois.ckCook Islandsianawiki21tt..ck
taketodeftake.towhois.toTongaianawiki6tt..to
taketoarmsdeftaketoar.mswhois.msMontserratianawiki10tt..ms
taketobedeftaketo.bewhois.beBelgiumianawiki8tt..be
taketodrinkingdeftaketodrinki.ngwhois.ngNigeriaianawiki14tt..ng
taketoflightdeftaketoflig.htwhois.htHaitiianawiki12tt..ht
taketomeandeftaketome.anwhois.anNetherlands Antillesianawiki10tt..an
taketoonesheelsdeftaketooneshee.lswhois.lsLesothoianawiki15tt..ls
taketopiecesdeftaketopiec.eswhois.esSpainianawiki12tt..es
taketotaskdeftaketota.skwhois.skSlovak Republicianawiki10tt..sk
taketotheairdeftaketothea.irwhois.irIran, Islamic Republic ofianawiki12tt..ir
taketothebosomdeftaketothebos.omwhois.omOmanianawiki14tt..om
taketothehustingsdeftaketothehustin.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki17tt..gs
taketotheroaddeftaketothero.adwhois.adAndorraianawiki13tt..ad
taketothestumpdeftaketothestu.mpwhois.mpNorthern Mariana Islandsianawiki14tt..mp
taketoyourarmsdeftaketoyourar.mswhois.msMontserratianawiki14tt..ms
taketoyourheelsdeftaketoyourhee.lswhois.lsLesothoianawiki15tt..ls
takeumbragedeftakeumbra.gewhois.geGeorgiaianawiki11tt..ge
takeunawaresdeftakeunawar.eswhois.esSpainianawiki12tt..es
takeunderyourwingdeftakeunderyourwi.ngwhois.ngNigeriaianawiki17tt..ng
takeupagaindeftakeupaga.inwhois.inIndiaianawiki11tt..in
takeuparmsdeftakeupar.mswhois.msMontserratianawiki10tt..ms
takeupasidedeftakeupasi.dewhois.deGermanyianawiki11tt..de
takeupsdeftakeu.pswhois.psPalestinian Territory (Occupied)ianawiki7tt..ps
takeupthecudgelsdeftakeupthecudge.lswhois.lsLesothoianawiki16tt..ls
takeupthecudgelsagainstdeftakeupthecudgelsagain.stwhois.stSao Tome and Principeianawiki23tt..st
takeupthegauntletdeftakeupthegauntl.etwhois.etEthiopiaianawiki17tt..et
takeupthehatchetdeftakeupthehatch.etwhois.etEthiopiaianawiki16tt..et
takeupwithdeftakeupwi.thwhois.thThailandianawiki10tt..th
takeupyourabodedeftakeupyourabo.dewhois.deGermanyianawiki15tt..de
takevowsdeftakevo.wswhois.wsWestern Samoaianawiki8tt..ws
takewhatcomesdeftakewhatcom.eswhois.esSpainianawiki13tt..es
takewingdeftakewi.ngwhois.ngNigeriaianawiki8tt..ng
takewithagrainofsaltdeftakewithagrainofsa.ltwhois.ltLithuaniaianawiki20tt..lt
takewrongdeftakewro.ngwhois.ngNigeriaianawiki9tt..ng
takeyoubackdeftakeyouba.ckwhois.ckCook Islandsianawiki11tt..ck
takeyourbearingsdeftakeyourbearin.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki16tt..gs
takeyourbusinesstodeftakeyourbusiness.towhois.toTongaianawiki18tt..to
takeyourconstitutionaldeftakeyourconstitution.alwhois.alAlbaniaianawiki22tt..al
takeyourcuefromdeftakeyourcuefr.omwhois.omOmanianawiki15tt..om
takeyourdeathdeftakeyourdea.thwhois.thThailandianawiki13tt..th
takeyourdeparturedeftakeyourdepartu.rewhois.reReunion Islandianawiki17tt..re
takeyourdustdeftakeyourdu.stwhois.stSao Tome and Principeianawiki12tt..st
takeyoureasedeftakeyourea.sewhois.seSwedenianawiki12tt..se
takeyourfancydeftakeyourfan.cywhois.cyCyprusianawiki13tt..cy
takeyourfootoffthegasdeftakeyourfootofftheg.aswhois.asAmerican Samoaianawiki21tt..as
takeyourhatofftodeftakeyourhatoff.towhois.toTongaianawiki16tt..to
takeyourlastbreathdeftakeyourlastbrea.thwhois.thThailandianawiki18tt..th
takeyourleavedeftakeyourlea.vewhois.veVenezuelaianawiki13tt..ve
takeyourleisuredeftakeyourleisu.rewhois.reReunion Islandianawiki15tt..re
takeyourlumpsdeftakeyourlum.pswhois.psPalestinian Territory (Occupied)ianawiki13tt..ps
takeyourmeasuredeftakeyourmeasu.rewhois.reReunion Islandianawiki15tt..re
takeyourmedicinedeftakeyourmedici.newhois.neNigerianawiki16tt..ne
takeyouroathdeftakeyouroa.thwhois.thThailandianawiki12tt..th
takeyouropinionsreadymadedeftakeyouropinionsreadyma.dewhois.deGermanyianawiki25tt..de
takeyourowncoursedeftakeyourowncour.sewhois.seSwedenianawiki17tt..se
takeyourpicturedeftakeyourpictu.rewhois.reReunion Islandianawiki15tt..re
takeyourpleasuredeftakeyourpleasu.rewhois.reReunion Islandianawiki16tt..re
takeyoursabbaticaldeftakeyoursabbatic.alwhois.alAlbaniaianawiki18tt..al
takeyourstandagainstdeftakeyourstandagain.stwhois.stSao Tome and Principeianawiki20tt..st
takeyourtradetodeftakeyourtrade.towhois.toTongaianawiki15tt..to
takhaardeftakha.arwhois.arArgentinaianawiki7tt..ar
takilmandeftakilm.anwhois.anNetherlands Antillesianawiki8tt..an
takindeftak.inwhois.inIndiaianawiki5tt..in
takingdeftaki.ngwhois.ngNigeriaianawiki6tt..ng
takingallthingstogetherdeftakingallthingstogeth.erwhois.erEritreaianawiki23tt..er
takingfromunderwrapsdeftakingfromunderwra.pswhois.psPalestinian Territory (Occupied)ianawiki20tt..ps
takingindeftaking.inwhois.inIndiaianawiki8tt..in
takingintoaccountthatdeftakingintoaccountth.atwhois.atAustriaianawiki21tt..at
takingleavedeftakinglea.vewhois.veVenezuelaianawiki11tt..ve
takinglydeftaking.lywhois.lyLibyan Arab Jamahiriyaianawiki8tt..ly
takingonethingwithanotherdeftakingonethingwithanoth.erwhois.erEritreaianawiki25tt..er
takingoverdeftakingov.erwhois.erEritreaianawiki10tt..er
takingsdeftakin.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki7tt..gs
takitumudeftakitu.muwhois.muMauritiusianawiki8tt..mu
takosisdeftakos.iswhois.isIcelandianawiki7tt..is
takydefta.kywhois.kyCayman Islandsianawiki4tt..ky
taldeft.alwhois.alAlbaniaianawiki3tt..al
taladefta.lawhois.laLao People's Democratic Republicianawiki4tt..la
talaemenesdeftalaemen.eswhois.esSpainianawiki10tt..es
talaingdeftalai.ngwhois.ngNigeriaianawiki7tt..ng
talajedeftala.jewhois.jeJerseyianawiki6tt..je
talaladeftala.lawhois.laLao People's Democratic Republicianawiki6tt..la
talamancadeftalaman.cawhois.caCanadaianawiki9tt..ca
talamancandeftalamanc.anwhois.anNetherlands Antillesianawiki10tt..an
talaniandeftalani.anwhois.anNetherlands Antillesianawiki8tt..an
talaodeftal.aowhois.aoAngolaianawiki5tt..ao
talapoindeftalapo.inwhois.inIndiaianawiki8tt..in
talardeftal.arwhois.arArgentinaianawiki5tt..ar
talasdeftal.aswhois.asAmerican Samoaianawiki5tt..as
talassiodeftalass.iowhois.ioBritish Indian Ocean Territoryianawiki8tt..io
talaveradelareinadeftalaveradelarei.nawhois.naNamibiaianawiki17tt..na
talbagumdeftalbag.umwhois.umUnited States Minor Outlying Islandsianawiki8tt..um
talbottdeftalbo.ttwhois.ttTrinidad and Tobagoianawiki7tt..tt
talbotypedeftalboty.pewhois.pePeruianawiki9tt..pe
talbotypistdeftalbotypi.stwhois.stSao Tome and Principeianawiki11tt..st
talcdefta.lcwhois.lcSaint Luciaianawiki4tt..lc
talcadeftal.cawhois.caCanadaianawiki5tt..ca
talcagumdeftalcag.umwhois.umUnited States Minor Outlying Islandsianawiki8tt..um
talcahuanodeftalcahua.nowhois.noNorwayianawiki10tt..no
talcbagdeftalcb.agwhois.agAntigua and Barbudaianawiki7tt..ag
talcbrickdeftalcbri.ckwhois.ckCook Islandsianawiki9tt..ck
talccubedeftalccu.bewhois.beBelgiumianawiki8tt..be
talcerdeftalc.erwhois.erEritreaianawiki6tt..er
talcfacingdeftalcfaci.ngwhois.ngNigeriaianawiki10tt..ng
talcgrindingdeftalcgrindi.ngwhois.ngNigeriaianawiki12tt..ng
talcherdeftalch.erwhois.erEritreaianawiki7tt..er
talcingdeftalci.ngwhois.ngNigeriaianawiki7tt..ng
talckdeftal.ckwhois.ckCook Islandsianawiki5tt..ck
talckingdeftalcki.ngwhois.ngNigeriaianawiki8tt..ng
talckydeftalc.kywhois.kyCayman Islandsianawiki6tt..ky
talclikedeftalcli.kewhois.keKenyaianawiki8tt..ke
talcodeftal.cowhois.coColombiaianawiki5tt..co
talcogumdeftalcog.umwhois.umUnited States Minor Outlying Islandsianawiki8tt..um
talcoiddeftalco.idwhois.idIndonesiaianawiki7tt..id
talcomicaceousdeftalcomicaceo.uswhois.usUnited Statesianawiki14tt..us
talcosedeftalco.sewhois.seSwedenianawiki7tt..se
talcottdeftalco.ttwhois.ttTrinidad and Tobagoianawiki7tt..tt
talcousdeftalco.uswhois.usUnited Statesianawiki7tt..us
talcpencildeftalcpenc.ilwhois.ilIsraelianawiki10tt..il
talcpulverizerdeftalcpulveriz.erwhois.erEritreaianawiki14tt..er
talcsdeftal.cswhois.csSerbia and Montenegroianawiki5tt..cs
talcschistdeftalcschi.stwhois.stSao Tome and Principeianawiki10tt..st
talcumdeftalc.umwhois.umUnited States Minor Outlying Islandsianawiki6tt..um
talcumpowderdeftalcumpowd.erwhois.erEritreaianawiki12tt..er
talcumsdeftalcu.mswhois.msMontserratianawiki7tt..ms
talebearerdeftalebear.erwhois.erEritreaianawiki10tt..er
talebearingdeftalebeari.ngwhois.ngNigeriaianawiki11tt..ng
talecarrierdeftalecarri.erwhois.erEritreaianawiki11tt..er
talecarryingdeftalecarryi.ngwhois.ngNigeriaianawiki12tt..ng
talegalladeftalegal.lawhois.laLao People's Democratic Republicianawiki9tt..la
talegallinaedeftalegallin.aewhois.aeUnited Arab Emiratesianawiki12tt..ae
talegallusdeftalegall.uswhois.usUnited Statesianawiki10tt..us
talehgumdeftalehg.umwhois.umUnited States Minor Outlying Islandsianawiki8tt..um
talemasterdeftalemast.erwhois.erEritreaianawiki10tt..er
talemongerdeftalemong.erwhois.erEritreaianawiki10tt..er
talemongeringdeftalemongeri.ngwhois.ngNigeriaianawiki13tt..ng
talenterdeftalent.erwhois.erEritreaianawiki8tt..er
talentingdeftalenti.ngwhois.ngNigeriaianawiki9tt..ng
taleofatubadeftaleofatu.bawhois.baBosnia and Herzegovinaianawiki11tt..ba
taleoftwocitiesadeftaleoftwocitie.sawhois.saSaudi Arabiaianawiki16tt..sa
talepyetdeftalepy.etwhois.etEthiopiaianawiki8tt..et
talerdeftal.erwhois.erEritreaianawiki5tt..er
talesdeftal.eswhois.esSpainianawiki5tt..es
talesmandeftalesm.anwhois.anNetherlands Antillesianawiki8tt..an
taletellerdeftaletell.erwhois.erEritreaianawiki10tt..er
taletellingdeftaletelli.ngwhois.ngNigeriaianawiki11tt..ng
talewisedeftalewi.sewhois.seSwedenianawiki8tt..se
taleysimdeftaleys.imwhois.imIsle of Manianawiki8tt..im
talhagumdeftalhag.umwhois.umUnited States Minor Outlying Islandsianawiki8tt..um
talidefta.liwhois.liLiechtensteinianawiki4tt..li
taliacotiandeftaliacoti.anwhois.anNetherlands Antillesianawiki11tt..an
taliagedeftalia.gewhois.geGeorgiaianawiki7tt..ge
talichdeftali.chwhois.chSwitzerlandianawiki6tt..ch
taliedeftal.iewhois.ieIrelandianawiki5tt..ie
taliesindeftalies.inwhois.inIndiaianawiki8tt..in
taliesinnorthdeftaliesinnor.thwhois.thThailandianawiki13tt..th
taliesinwestdeftaliesinwe.stwhois.stSao Tome and Principeianawiki12tt..st
taligradedeftaligra.dewhois.deGermanyianawiki9tt..de
talihinadeftalihi.nawhois.naNamibiaianawiki8tt..na
talinumdeftalin.umwhois.umUnited States Minor Outlying Islandsianawiki7tt..um
taliodeftal.iowhois.ioBritish Indian Ocean Territoryianawiki5tt..io
talionisdeftalion.iswhois.isIcelandianawiki8tt..is
talipatdeftalip.atwhois.atAustriaianawiki7tt..at
talipesdeftalip.eswhois.esSpainianawiki7tt..es
talipomanusdeftalipoman.uswhois.usUnited Statesianawiki11tt..us
talisdeftal.iswhois.isIcelandianawiki5tt..is
talismandeftalism.anwhois.anNetherlands Antillesianawiki8tt..an
talismanicaldeftalismanic.alwhois.alAlbaniaianawiki12tt..al
talismanicallydeftalismanical.lywhois.lyLibyan Arab Jamahiriyaianawiki14tt..ly
talismanistdeftalismani.stwhois.stSao Tome and Principeianawiki11tt..st
talismannideftalisman.niwhois.niNicaraguaianawiki10tt..ni
talkdefta.lkwhois.lkSri Lankaianawiki4tt..lk
talkatdeftalk.atwhois.atAustriaianawiki6tt..at
talkativedeftalkati.vewhois.veVenezuelaianawiki9tt..ve
talkativelydeftalkative.lywhois.lyLibyan Arab Jamahiriyaianawiki11tt..ly
talkbackdeftalkba.ckwhois.ckCook Islandsianawiki8tt..ck
talkbetweenshipsdeftalkbetweenshi.pswhois.psPalestinian Territory (Occupied)ianawiki16tt..ps
talkdoubledutchdeftalkdoubledut.chwhois.chSwitzerlandianawiki15tt..ch
talkdowntodeftalkdown.towhois.toTongaianawiki10tt..to
talkeedeftalk.eewhois.eeEstoniaianawiki6tt..ee
talkeetalkeedeftalkeetalk.eewhois.eeEstoniaianawiki12tt..ee
talkerdeftalk.erwhois.erEritreaianawiki6tt..er
talkfestdeftalkfe.stwhois.stSao Tome and Principeianawiki8tt..st
talkhighfalutindeftalkhighfalut.inwhois.inIndiaianawiki15tt..in
talkidlydeftalkid.lywhois.lyLibyan Arab Jamahiriyaianawiki8tt..ly
talkiedeftalk.iewhois.ieIrelandianawiki6tt..ie
talkierdeftalki.erwhois.erEritreaianawiki7tt..er
talkiesdeftalki.eswhois.esSpainianawiki7tt..es
talkiestdeftalkie.stwhois.stSao Tome and Principeianawiki8tt..st
talkindeftalk.inwhois.inIndiaianawiki6tt..in
talkincoherentlydeftalkincoherent.lywhois.lyLibyan Arab Jamahiriyaianawiki16tt..ly
talkingdeftalki.ngwhois.ngNigeriaianawiki7tt..ng
talkingmachinedeftalkingmachi.newhois.neNigerianawiki14tt..ne
talkingpicturedeftalkingpictu.rewhois.reReunion Islandianawiki14tt..re
talkingpointdeftalkingpo.intwhois.intInternational Organizationsianawiki12tt..int
talkingsdeftalkin.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki8tt..gs
talkingthroughyournosedeftalkingthroughyourno.sewhois.seSwedenianawiki22tt..se
talkingtodeftalking.towhois.toTongaianawiki9tt..to
talkingtohearyourselftalkdeftalkingtohearyourselfta.lkwhois.lkSri Lankaianawiki25tt..lk
talkinsuperlativesdeftalkinsuperlativ.eswhois.esSpainianawiki18tt..es
talkintodeftalkin.towhois.toTongaianawiki8tt..to
talknonsensedeftalknonsen.sewhois.seSwedenianawiki12tt..se
talkoffthetopofyourheaddeftalkoffthetopofyourhe.adwhois.adAndorraianawiki23tt..ad
talkoverdeftalkov.erwhois.erEritreaianawiki8tt..er
talkthroughyourhatdeftalkthroughyourh.atwhois.atAustriaianawiki18tt..at
talktodeftalk.towhois.toTongaianawiki6tt..to
talktodeathdeftalktodea.thwhois.thThailandianawiki11tt..th
talktogetherdeftalktogeth.erwhois.erEritreaianawiki12tt..er
talktoomuchdeftalktoomu.chwhois.chSwitzerlandianawiki11tt..ch
talkwithdeftalkwi.thwhois.thThailandianawiki8tt..th
talkwithonedeftalkwitho.newhois.neNigerianawiki11tt..ne
talkydeftal.kywhois.kyCayman Islandsianawiki5tt..ky
talkyouintoafeverdeftalkyouintoafev.erwhois.erEritreaianawiki17tt..er
talkyourheaddeftalkyourhe.adwhois.adAndorraianawiki12tt..ad
talkyourselfhoarsedeftalkyourselfhoar.sewhois.seSwedenianawiki18tt..se
talkyourselfoutofbreathdeftalkyourselfoutofbrea.thwhois.thThailandianawiki23tt..th
talkyoutodeathdeftalkyoutodea.thwhois.thThailandianawiki14tt..th
talkytalkdeftalkyta.lkwhois.lkSri Lankaianawiki9tt..lk
talkytalkydeftalkytal.kywhois.kyCayman Islandsianawiki10tt..ky
talladegadeftallade.gawhois.gaGabonianawiki9tt..ga
tallagedeftalla.gewhois.geGeorgiaianawiki7tt..ge
tallagesdeftallag.eswhois.esSpainianawiki8tt..es
tallagingdeftallagi.ngwhois.ngNigeriaianawiki9tt..ng
tallahasseedeftallahass.eewhois.eeEstoniaianawiki11tt..ee
tallaisimdeftallais.imwhois.imIsle of Manianawiki9tt..im
tallaismdeftallai.smwhois.smSan Marinoianawiki8tt..sm
tallapoosadeftallapoo.sawhois.saSaudi Arabiaianawiki10tt..sa
tallasseedeftallass.eewhois.eeEstoniaianawiki9tt..ee
tallbottdeftallbo.ttwhois.ttTrinidad and Tobagoianawiki8tt..tt
tallbuiltdeftallbui.ltwhois.ltLithuaniaianawiki9tt..lt
tallcaseclockdeftallcaseclo.ckwhois.ckCook Islandsianawiki13tt..ck
tallcoreopsisdeftallcoreops.iswhois.isIcelandianawiki13tt..is
tallegadeftalle.gawhois.gaGabonianawiki7tt..ga
tallegalanedeftallegala.newhois.neNigerianawiki11tt..ne
tallerdeftall.erwhois.erEritreaianawiki6tt..er
tallerodeftalle.rowhois.roRomaniaianawiki7tt..ro
tallesdeftall.eswhois.esSpainianawiki6tt..es
tallestdeftalle.stwhois.stSao Tome and Principeianawiki7tt..st
talletdeftall.etwhois.etEthiopiaianawiki6tt..et
tallevastdeftalleva.stwhois.stSao Tome and Principeianawiki9tt..st
tallgrowingdeftallgrowi.ngwhois.ngNigeriaianawiki11tt..ng
tallideftal.liwhois.liLiechtensteinianawiki5tt..li
talliagedeftallia.gewhois.geGeorgiaianawiki8tt..ge
talliardeftalli.arwhois.arArgentinaianawiki7tt..ar
talliatingdeftalliati.ngwhois.ngNigeriaianawiki10tt..ng
talliatumdeftalliat.umwhois.umUnited States Minor Outlying Islandsianawiki9tt..um
talliedeftall.iewhois.ieIrelandianawiki6tt..ie
tallierdeftalli.erwhois.erEritreaianawiki7tt..er
talliesdeftalli.eswhois.esSpainianawiki7tt..es
tallisdeftall.iswhois.isIcelandianawiki6tt..is
tallishdeftalli.shwhois.shSaint Helenaianawiki7tt..sh
tallitdeftall.itwhois.itItalyianawiki6tt..it
tallithdeftalli.thwhois.thThailandianawiki7tt..th
tallithesdeftallith.eswhois.esSpainianawiki9tt..es
tallithimdeftallith.imwhois.imIsle of Manianawiki9tt..im
tallithkatandeftallithkat.anwhois.anNetherlands Antillesianawiki12tt..an
tallitimdeftallit.imwhois.imIsle of Manianawiki8tt..im
tallitothdeftallito.thwhois.thThailandianawiki9tt..th
talllookingdeftalllooki.ngwhois.ngNigeriaianawiki11tt..ng
tallmadgedeftallmad.gewhois.geGeorgiaianawiki9tt..ge
tallmandeftallm.anwhois.anNetherlands Antillesianawiki7tt..an
tallmasterdeftallmast.erwhois.erEritreaianawiki10tt..er
tallmeadowoatdeftallmeadowo.atwhois.atAustriaianawiki13tt..at
tallnessesdeftallness.eswhois.esSpainianawiki10tt..es
talloildeftallo.ilwhois.ilIsraelianawiki7tt..il
tallolsdeftallo.lswhois.lsLesothoianawiki7tt..ls
tallorderdeftallord.erwhois.erEritreaianawiki9tt..er
tallowberriesdeftallowberri.eswhois.esSpainianawiki13tt..es
tallowcatchdeftallowcat.chwhois.chSwitzerlandianawiki11tt..ch
tallowchandlerdeftallowchandl.erwhois.erEritreaianawiki14tt..er
tallowchandleringdeftallowchandleri.ngwhois.ngNigeriaianawiki17tt..ng
tallowchandlingdeftallowchandli.ngwhois.ngNigeriaianawiki15tt..ng
tallowcoolerdeftallowcool.erwhois.erEritreaianawiki12tt..er
tallowcracklingdeftallowcrackli.ngwhois.ngNigeriaianawiki15tt..ng
tallowcutterdeftallowcutt.erwhois.erEritreaianawiki12tt..er
tallowerdeftallow.erwhois.erEritreaianawiki8tt..er
tallowingdeftallowi.ngwhois.ngNigeriaianawiki9tt..ng
tallowishdeftallowi.shwhois.shSaint Helenaianawiki9tt..sh
tallowlikedeftallowli.kewhois.keKenyaianawiki10tt..ke
tallowloafdeftallowlo.afwhois.afAfghanistanianawiki10tt..af
tallowmakerdeftallowmak.erwhois.erEritreaianawiki11tt..er
tallowmakingdeftallowmaki.ngwhois.ngNigeriaianawiki12tt..ng
tallowmandeftallowm.anwhois.anNetherlands Antillesianawiki9tt..an
tallowmangedeftallowman.gewhois.geGeorgiaianawiki11tt..ge
tallowmelterdeftallowmelt.erwhois.erEritreaianawiki12tt..er
tallowoildeftallowo.ilwhois.ilIsraelianawiki9tt..il
tallowrefinerdeftallowrefin.erwhois.erEritreaianawiki13tt..er
tallowrendererdeftallowrender.erwhois.erEritreaianawiki14tt..er
tallowrootdeftallow.rootwhois.rootRoot Server InfrastructureN/Awiki10tt..root
tallowsdeftallo.wswhois.wsWestern Samoaianawiki7tt..ws
tallowsamplerdeftallowsampl.erwhois.erEritreaianawiki13tt..er
tallowtreedeftallowtr.eewhois.eeEstoniaianawiki10tt..ee
tallpoppydeftallpop.pywhois.pyParaguayianawiki9tt..py
tallsittingdeftallsitti.ngwhois.ngNigeriaianawiki11tt..ng
tallsunflowerdeftallsunflow.erwhois.erEritreaianawiki13tt..er
talltalkdeftallta.lkwhois.lkSri Lankaianawiki8tt..lk
talludeftal.luwhois.luLuxembourgianawiki5tt..lu
talluladeftallu.lawhois.laLao People's Democratic Republicianawiki7tt..la
tallydeftal.lywhois.lyLibyan Arab Jamahiriyaianawiki5tt..ly
tallyhobackdeftallyhoba.ckwhois.ckCook Islandsianawiki11tt..ck
tallyhocoachdeftallyhocoa.chwhois.chSwitzerlandianawiki12tt..ch
tallyhoingdeftallyhoi.ngwhois.ngNigeriaianawiki10tt..ng
tallyhooverdeftallyhoov.erwhois.erEritreaianawiki11tt..er
tallyingdeftallyi.ngwhois.ngNigeriaianawiki8tt..ng
tallymandeftallym.anwhois.anNetherlands Antillesianawiki8tt..an
tallyplandeftallypl.anwhois.anNetherlands Antillesianawiki9tt..an
tallyroomdeftallyro.omwhois.omOmanianawiki9tt..om
tallysheetdeftallyshe.etwhois.etEthiopiaianawiki10tt..et
tallystickdeftallysti.ckwhois.ckCook Islandsianawiki10tt..ck
tallytradedeftallytra.dewhois.deGermanyianawiki10tt..de
tallywagdeftallyw.agwhois.agAntigua and Barbudaianawiki8tt..ag
tallywalkdeftallywa.lkwhois.lkSri Lankaianawiki9tt..lk
tallywithdeftallywi.thwhois.thThailandianawiki9tt..th
tallywomandeftallywom.anwhois.anNetherlands Antillesianawiki10tt..an
talmadeftal.mawhois.maMoroccoianawiki5tt..ma
talmagedeftalma.gewhois.geGeorgiaianawiki7tt..ge
talmasdeftalm.aswhois.asAmerican Samoaianawiki6tt..as
talmodeftal.mowhois.moMacauianawiki5tt..mo
talmousedeftalmou.sewhois.seSwedenianawiki8tt..se
talmudicaldeftalmudic.alwhois.alAlbaniaianawiki10tt..al
talmudismdeftalmudi.smwhois.smSan Marinoianawiki9tt..sm
talmudistdeftalmudi.stwhois.stSao Tome and Principeianawiki9tt..st
talmudisticaldeftalmudistic.alwhois.alAlbaniaianawiki13tt..al
talocalcanealdeftalocalcane.alwhois.alAlbaniaianawiki13tt..al
talocalcaneandeftalocalcane.anwhois.anNetherlands Antillesianawiki13tt..an
talocruraldeftalocrur.alwhois.alAlbaniaianawiki10tt..al
talofibulardeftalofibul.arwhois.arArgentinaianawiki11tt..ar
talogadeftalo.gawhois.gaGabonianawiki6tt..ga
talonaviculardeftalonavicul.arwhois.arArgentinaianawiki13tt..ar
taloniddeftalon.idwhois.idIndonesiaianawiki7tt..id
talookasdeftalook.aswhois.asAmerican Samoaianawiki8tt..as
taloscaphoiddeftaloscapho.idwhois.idIndonesiaianawiki12tt..id
talosedeftalo.sewhois.seSwedenianawiki6tt..se
talotibialdeftalotibi.alwhois.alAlbaniaianawiki10tt..al
talpadeftal.pawhois.paPanamaianawiki5tt..pa
talpicidedeftalpici.dewhois.deGermanyianawiki9tt..de
talpiddeftalp.idwhois.idIndonesiaianawiki6tt..id
talpidaedeftalpid.aewhois.aeUnited Arab Emiratesianawiki8tt..ae
talpinedeftalpi.newhois.neNigerianawiki7tt..ne
talpoiddeftalpo.idwhois.idIndonesiaianawiki7tt..id
talshidedeftalshi.dewhois.deGermanyianawiki8tt..de
taltarumdeftaltar.umwhois.umUnited States Minor Outlying Islandsianawiki8tt..um
talterdeftalt.erwhois.erEritreaianawiki6tt..er
talthybiusdeftalthybi.uswhois.usUnited Statesianawiki10tt..us
taltushtuntudedeftaltushtuntu.dewhois.deGermanyianawiki14tt..de
taluhetdeftaluh.etwhois.etEthiopiaianawiki7tt..et
talukdeftal.ukwhois.ukUnited Kingdomianawiki5tt..uk
talukasdeftaluk.aswhois.asAmerican Samoaianawiki7tt..as
talukdardeftalukd.arwhois.arArgentinaianawiki8tt..ar
talusdeftal.uswhois.usUnited Statesianawiki5tt..us
talusesdeftalus.eswhois.esSpainianawiki7tt..es
talutodeftalu.towhois.toTongaianawiki6tt..to
talwardeftalw.arwhois.arArgentinaianawiki6tt..ar
talwegdeftalw.egwhois.egEgyptianawiki6tt..eg
talyshindeftalysh.inwhois.inIndiaianawiki8tt..in
tamdeft.amwhois.amArmeniaianawiki3tt..am
tamadefta.mawhois.maMoroccoianawiki4tt..ma
tamablydeftamab.lywhois.lyLibyan Arab Jamahiriyaianawiki7tt..ly
tamaceaedeftamace.aewhois.aeUnited Arab Emiratesianawiki8tt..ae
tamacoaredeftamacoa.rewhois.reReunion Islandianawiki9tt..re
tamaldeftam.alwhois.alAlbaniaianawiki5tt..al
tamalepiedeftamalep.iewhois.ieIrelandianawiki9tt..ie
tamalesdeftamal.eswhois.esSpainianawiki7tt..es
tamalsdeftama.lswhois.lsLesothoianawiki6tt..ls
tamanacdeftaman.acwhois.acAscension Islandianawiki7tt..ac
tamanacadeftamana.cawhois.caCanadaianawiki8tt..ca
tamanacodeftamana.cowhois.coColombiaianawiki8tt..co
tamanduadeftamand.uawhois.uaUkraineianawiki8tt..ua
tamanduasdeftamandu.aswhois.asAmerican Samoaianawiki9tt..as
tamandusdeftamand.uswhois.usUnited Statesianawiki8tt..us
tamanduydeftamand.uywhois.uyUruguayianawiki8tt..uy
tamanoasdeftamano.aswhois.asAmerican Samoaianawiki8tt..as
tamanoirdeftamano.irwhois.irIran, Islamic Republic ofianawiki8tt..ir
tamanowusdeftamanow.uswhois.usUnited Statesianawiki9tt..us
tamanudeftama.nuwhois.nuNiueianawiki6tt..nu
tamaquadeftamaq.uawhois.uaUkraineianawiki7tt..ua
tamardeftam.arwhois.arArgentinaianawiki5tt..ar
tamarackdeftamara.ckwhois.ckCook Islandsianawiki8tt..ck
tamarackpinedeftamarackpi.newhois.neNigerianawiki12tt..ne
tamaraodeftamar.aowhois.aoAngolaianawiki7tt..ao
tamaraudeftamar.auwhois.auAustraliaianawiki7tt..au
tamarausdeftamara.uswhois.usUnited Statesianawiki8tt..us
tamaricaceaedeftamaricace.aewhois.aeUnited Arab Emiratesianawiki12tt..ae
tamaricaceousdeftamaricaceo.uswhois.usUnited Statesianawiki13tt..us
tamarindeftamar.inwhois.inIndiaianawiki7tt..in
tamarindfishdeftamarindfi.shwhois.shSaint Helenaianawiki12tt..sh
tamarindplumdeftamarindpl.umwhois.umUnited States Minor Outlying Islandsianawiki12tt..um
tamarindusdeftamarind.uswhois.usUnited Statesianawiki10tt..us
tamarisdeftamar.iswhois.isIcelandianawiki7tt..is
tamariskdeftamari.skwhois.skSlovak Republicianawiki8tt..sk
tamariskfamilydeftamariskfami.lywhois.lyLibyan Arab Jamahiriyaianawiki14tt..ly
tamarisksaltdeftamarisksa.ltwhois.ltLithuaniaianawiki12tt..lt
tamarisksalttreedeftamarisksalttr.eewhois.eeEstoniaianawiki16tt..ee
tamarixfamilydeftamarixfami.lywhois.lyLibyan Arab Jamahiriyaianawiki13tt..ly
tamarudeftama.ruwhois.ruRussian Federationianawiki6tt..ru
tamasdeftam.aswhois.asAmerican Samoaianawiki5tt..as
tamashasdeftamash.aswhois.asAmerican Samoaianawiki8tt..as
tamasinedeftamasi.newhois.neNigerianawiki8tt..ne
tamasseedeftamass.eewhois.eeEstoniaianawiki8tt..ee
tamatavedeftamata.vewhois.veVenezuelaianawiki8tt..ve
tamaulipasdeftamaulip.aswhois.asAmerican Samoaianawiki10tt..as
tamaulipecdeftamaulip.ecwhois.ecEcuadorianawiki10tt..ec
tamaulipecandeftamaulipec.anwhois.anNetherlands Antillesianawiki12tt..an
tambacdeftamb.acwhois.acAscension Islandianawiki6tt..ac
tambacsdeftamba.cswhois.csSerbia and Montenegroianawiki7tt..cs
tambaladeftamba.lawhois.laLao People's Democratic Republicianawiki7tt..la
tambalasdeftambal.aswhois.asAmerican Samoaianawiki8tt..as
tamberdeftamb.erwhois.erEritreaianawiki6tt..er
tambodeftam.bowhois.boBoliviaianawiki5tt..bo
tambookiedeftambook.iewhois.ieIrelandianawiki9tt..ie
tamboukideftambou.kiwhois.kiKiribatiianawiki8tt..ki
tambourasdeftambour.aswhois.asAmerican Samoaianawiki9tt..as
tambourclockdeftambourclo.ckwhois.ckCook Islandsianawiki12tt..ck
tambourerdeftambour.erwhois.erEritreaianawiki9tt..er
tambouretdeftambour.etwhois.etEthiopiaianawiki9tt..et
tambourgideftambour.giwhois.giGibraltarianawiki9tt..gi
tambourindeftambour.inwhois.inIndiaianawiki9tt..in
tambourinadedeftambourina.dewhois.deGermanyianawiki12tt..de
tambourinedeftambouri.newhois.neNigerianawiki10tt..ne
tambourinesdeftambourin.eswhois.esSpainianawiki11tt..es
tambouringdeftambouri.ngwhois.ngNigeriaianawiki10tt..ng
tambouristdeftambouri.stwhois.stSao Tome and Principeianawiki10tt..st
tambourstitchdeftambourstit.chwhois.chSwitzerlandianawiki13tt..ch
tambourstitcherdeftambourstitch.erwhois.erEritreaianawiki15tt..er
tambreetdeftambre.etwhois.etEthiopiaianawiki8tt..et
tambukideftambu.kiwhois.kiKiribatiianawiki7tt..ki
tamburandeftambur.anwhois.anNetherlands Antillesianawiki8tt..an
tamburasdeftambur.aswhois.asAmerican Samoaianawiki8tt..as
tamburitzadeftamburit.zawhois.zaSouth Africaianawiki10tt..za
tamburlainedeftamburlai.newhois.neNigerianawiki11tt..ne
tamburlainethegreatdeftamburlainethegre.atwhois.atAustriaianawiki19tt..at
tamburonedeftamburo.newhois.neNigerianawiki9tt..ne
tameindeftame.inwhois.inIndiaianawiki6tt..in
tamelesslydeftameless.lywhois.lyLibyan Arab Jamahiriyaianawiki10tt..ly
tamelookingdeftamelooki.ngwhois.ngNigeriaianawiki11tt..ng
tamelydeftame.lywhois.lyLibyan Arab Jamahiriyaianawiki6tt..ly
tamenesdeftamen.eswhois.esSpainianawiki7tt..es
tamenessesdeftameness.eswhois.esSpainianawiki10tt..es
tamerdeftam.erwhois.erEritreaianawiki5tt..er
tamerlanedeftamerla.newhois.neNigerianawiki9tt..ne
tamerlanismdeftamerlani.smwhois.smSan Marinoianawiki11tt..sm
tamesdeftam.eswhois.esSpainianawiki5tt..es
tamestdeftame.stwhois.stSao Tome and Principeianawiki6tt..st
tamiasdeftami.aswhois.asAmerican Samoaianawiki6tt..as
tamidinedeftamidi.newhois.neNigerianawiki8tt..ne
tamildeftam.ilwhois.ilIsraelianawiki5tt..il
tamildefta.milwhois.milUS Militaryianawiki5tt..mil
tamiliandeftamili.anwhois.anNetherlands Antillesianawiki8tt..an
tamilsdeftami.lswhois.lsLesothoianawiki6tt..ls
taminedeftami.newhois.neNigerianawiki6tt..ne
tamingdeftami.ngwhois.ngNigeriaianawiki6tt..ng
tamisdeftam.iswhois.isIcelandianawiki5tt..is
tamisedeftami.sewhois.seSwedenianawiki6tt..se
tamisesdeftamis.eswhois.esSpainianawiki7tt..es
tamlungdeftamlu.ngwhois.ngNigeriaianawiki7tt..ng
tammadeftam.mawhois.maMoroccoianawiki5tt..ma
tammanialdeftammani.alwhois.alAlbaniaianawiki9tt..al
tammanyismdeftammanyi.smwhois.smSan Marinoianawiki10tt..sm
tammanymandeftammanym.anwhois.anNetherlands Antillesianawiki10tt..an
tammardeftamm.arwhois.arArgentinaianawiki6tt..ar
tammiedeftamm.iewhois.ieIrelandianawiki6tt..ie
tammienoriedeftammienor.iewhois.ieIrelandianawiki11tt..ie
tammiesdeftammi.eswhois.esSpainianawiki7tt..es
tammliedeftamml.iewhois.ieIrelandianawiki7tt..ie
tammockdeftammo.ckwhois.ckCook Islandsianawiki7tt..ck
tammsdeftam.mswhois.msMontserratianawiki5tt..ms
tammuzdeftamm.uzwhois.uzUzbekistanianawiki6tt..uz
tammydeftam.mywhois.myMalaysiaianawiki5tt..my
tammyclothdeftammyclo.thwhois.thThailandianawiki10tt..th
tamoshanterdeftamoshant.erwhois.erEritreaianawiki11tt..er
tampdefta.mpwhois.mpNorthern Mariana Islandsianawiki4tt..mp
tampadeftam.pawhois.paPanamaianawiki5tt..pa
tampaladeftampa.lawhois.laLao People's Democratic Republicianawiki7tt..la
tampalasdeftampal.aswhois.asAmerican Samoaianawiki8tt..as
tampandeftamp.anwhois.anNetherlands Antillesianawiki6tt..an
tampangdeftampa.ngwhois.ngNigeriaianawiki7tt..ng
tamperdeftamp.erwhois.erEritreaianawiki6tt..er
tamperedeftampe.rewhois.reReunion Islandianawiki7tt..re
tamperedwithdeftamperedwi.thwhois.thThailandianawiki12tt..th
tampererdeftamper.erwhois.erEritreaianawiki8tt..er
tamperingdeftamperi.ngwhois.ngNigeriaianawiki9tt..ng
tamperwithdeftamperwi.thwhois.thThailandianawiki10tt..th
tampicodeftampi.cowhois.coColombiaianawiki7tt..co
tampindeftamp.inwhois.inIndiaianawiki6tt..in
tampingdeftampi.ngwhois.ngNigeriaianawiki7tt..ng
tampingbardeftampingb.arwhois.arArgentinaianawiki10tt..ar
tampingpickdeftampingpi.ckwhois.ckCook Islandsianawiki11tt..ck
tampingstickdeftampingsti.ckwhois.ckCook Islandsianawiki12tt..ck
tamponadedeftampona.dewhois.deGermanyianawiki9tt..de
tamponagedeftampona.gewhois.geGeorgiaianawiki9tt..ge
tamponingdeftamponi.ngwhois.ngNigeriaianawiki9tt..ng
tampsdeftam.pswhois.psPalestinian Territory (Occupied)ianawiki5tt..ps
tamsdefta.mswhois.msMontserratianawiki4tt..ms
tamskydeftams.kywhois.kyCayman Islandsianawiki6tt..ky
tamtamdeftamt.amwhois.amArmeniaianawiki6tt..am
tamuliandeftamuli.anwhois.anNetherlands Antillesianawiki8tt..an
tamuredeftamu.rewhois.reReunion Islandianawiki6tt..re
tamusdeftam.uswhois.usUnited Statesianawiki5tt..us
tamworthdeftamwor.thwhois.thThailandianawiki8tt..th
tamzinedeftamzi.newhois.neNigerianawiki7tt..ne
tandeft.anwhois.anNetherlands Antillesianawiki3tt..an
tanadefta.nawhois.naNamibiaianawiki4tt..na
tanacetindeftanacet.inwhois.inIndiaianawiki9tt..in
tanacetonedeftanaceto.newhois.neNigerianawiki10tt..ne
tanacetumdeftanacet.umwhois.umUnited States Minor Outlying Islandsianawiki9tt..um
tanachdeftana.chwhois.chSwitzerlandianawiki6tt..ch
tanadardeftanad.arwhois.arArgentinaianawiki7tt..ar
tanagerdeftanag.erwhois.erEritreaianawiki7tt..er
tanagraeandeftanagrae.anwhois.anNetherlands Antillesianawiki10tt..an
tanagrafiguredeftanagrafigu.rewhois.reReunion Islandianawiki13tt..re
tanagridaedeftanagrid.aewhois.aeUnited Arab Emiratesianawiki10tt..ae
tanagrinedeftanagri.newhois.neNigerianawiki9tt..ne
tanagroiddeftanagro.idwhois.idIndonesiaianawiki9tt..id
tanaistdeftanai.stwhois.stSao Tome and Principeianawiki7tt..st
tanaladeftana.lawhois.laLao People's Democratic Republicianawiki6tt..la
tanandeftan.anwhois.anNetherlands Antillesianawiki5tt..an
tananadeftana.nawhois.naNamibiaianawiki6tt..na
tananarivedeftananari.vewhois.veVenezuelaianawiki10tt..ve
tanaquildeftanaqu.ilwhois.ilIsraelianawiki8tt..il
tanbarktreedeftanbarktr.eewhois.eeEstoniaianawiki11tt..ee
tanburningdeftanburni.ngwhois.ngNigeriaianawiki10tt..ng
tanchelmiandeftanchelmi.anwhois.anNetherlands Antillesianawiki11tt..an
tanchoirdeftancho.irwhois.irIran, Islamic Republic ofianawiki8tt..ir
tandandeftand.anwhois.anNetherlands Antillesianawiki6tt..an
tandavadeftanda.vawhois.vaHoly See (Vatican City State)ianawiki7tt..va
tandemerdeftandem.erwhois.erEritreaianawiki8tt..er
tandemistdeftandemi.stwhois.stSao Tome and Principeianawiki9tt..st
tandemplanedeftandempla.newhois.neNigerianawiki11tt..ne
tandempunchdeftandempun.chwhois.chSwitzerlandianawiki11tt..ch
tandemrotorhelicopterdeftandemrotorhelicopt.erwhois.erEritreaianawiki21tt..er
tandemsdeftande.mswhois.msMontserratianawiki7tt..ms
tandemseatdeftandemse.atwhois.atAustriaianawiki10tt..at
tandemwisedeftandemwi.sewhois.seSwedenianawiki10tt..se
tandiedeftand.iewhois.ieIrelandianawiki6tt..ie
tanedefta.newhois.neNigerianawiki4tt..ne
tanegadeftane.gawhois.gaGabonianawiki6tt..ga
tangdefta.ngwhois.ngNigeriaianawiki4tt..ng
tangadeftan.gawhois.gaGabonianawiki5tt..ga
tangalungdeftangalu.ngwhois.ngNigeriaianawiki9tt..ng
tangantangandeftangantang.anwhois.anNetherlands Antillesianawiki12tt..an
tanganyikaandzanzibardeftanganyikaandzanzib.arwhois.arArgentinaianawiki21tt..ar
tanganyikandeftanganyik.anwhois.anNetherlands Antillesianawiki11tt..an
tangaridaedeftangarid.aewhois.aeUnited Arab Emiratesianawiki10tt..ae
tangaroandeftangaro.anwhois.anNetherlands Antillesianawiki9tt..an
tangencesdeftangenc.eswhois.esSpainianawiki9tt..es
tangenciesdeftangenci.eswhois.esSpainianawiki10tt..es
tangencydeftangen.cywhois.cyCyprusianawiki8tt..cy
tangentaldeftangent.alwhois.alAlbaniaianawiki9tt..al
tangentallydeftangental.lywhois.lyLibyan Arab Jamahiriyaianawiki11tt..ly
tangentgalvanometerdeftangentgalvanomet.erwhois.erEritreaianawiki19tt..er
tangentialdeftangenti.alwhois.alAlbaniaianawiki10tt..al
tangentiallydeftangential.lywhois.lyLibyan Arab Jamahiriyaianawiki12tt..ly
tangentlydeftangent.lywhois.lyLibyan Arab Jamahiriyaianawiki9tt..ly
tangentplanedeftangentpla.newhois.neNigerianawiki12tt..ne
tangentsawdeftangents.awwhois.awArubaianawiki10tt..aw
tangentsawingdeftangentsawi.ngwhois.ngNigeriaianawiki13tt..ng
tangerdeftang.erwhois.erEritreaianawiki6tt..er
tangerinedeftangeri.newhois.neNigerianawiki9tt..ne
tangerinesdeftangerin.eswhois.esSpainianawiki10tt..es
tangfishdeftangfi.shwhois.shSaint Helenaianawiki8tt..sh
tangfishesdeftangfish.eswhois.esSpainianawiki10tt..es
tanghamdeftangh.amwhois.amArmeniaianawiki7tt..am
tanghandeftangh.anwhois.anNetherlands Antillesianawiki7tt..an
tanghindeftangh.inwhois.inIndiaianawiki7tt..in
tanghinindeftanghin.inwhois.inIndiaianawiki9tt..in
tangideftan.giwhois.giGibraltarianawiki5tt..gi
tangibilitiesdeftangibiliti.eswhois.esSpainianawiki13tt..es
tangiblesdeftangibl.eswhois.esSpainianawiki9tt..es
tangiblydeftangib.lywhois.lyLibyan Arab Jamahiriyaianawiki8tt..ly
tangiedeftang.iewhois.ieIrelandianawiki6tt..ie
tangierdeftangi.erwhois.erEritreaianawiki7tt..er
tangierocherdeftangieroch.erwhois.erEritreaianawiki12tt..er
tangiestdeftangie.stwhois.stSao Tome and Principeianawiki8tt..st
tangilindeftangil.inwhois.inIndiaianawiki8tt..in
tangingdeftangi.ngwhois.ngNigeriaianawiki7tt..ng
tangladdeftangl.adwhois.adAndorraianawiki7tt..ad
tangleberriesdeftangleberri.eswhois.esSpainianawiki13tt..es
tangledindeftangled.inwhois.inIndiaianawiki9tt..in
tangledskeindeftangledske.inwhois.inIndiaianawiki12tt..in
tanglefishdeftanglefi.shwhois.shSaint Helenaianawiki10tt..sh
tanglefishesdeftanglefish.eswhois.esSpainianawiki12tt..es
tangleheaddeftanglehe.adwhois.adAndorraianawiki10tt..ad
tanglelegsdeftanglele.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki10tt..gs
tanglepickerdeftanglepick.erwhois.erEritreaianawiki12tt..er
tanglerdeftangl.erwhois.erEritreaianawiki7tt..er
tanglerootdeftangle.rootwhois.rootRoot Server InfrastructureN/Awiki10tt..root
tanglesdeftangl.eswhois.esSpainianawiki7tt..es
tangletaildeftangleta.ilwhois.ilIsraelianawiki10tt..il
tangleupwithdeftangleupwi.thwhois.thThailandianawiki12tt..th
tanglewithdeftanglewi.thwhois.thThailandianawiki10tt..th
tanglewrackdeftanglewra.ckwhois.ckCook Islandsianawiki11tt..ck
tanglierdeftangli.erwhois.erEritreaianawiki8tt..er
tangliestdeftanglie.stwhois.stSao Tome and Principeianawiki9tt..st
tanglingdeftangli.ngwhois.ngNigeriaianawiki8tt..ng
tanglinglydeftangling.lywhois.lyLibyan Arab Jamahiriyaianawiki10tt..ly
tanglydeftang.lywhois.lyLibyan Arab Jamahiriyaianawiki6tt..ly
tangoingdeftangoi.ngwhois.ngNigeriaianawiki8tt..ng
tangramdeftangr.amwhois.amArmeniaianawiki7tt..am
tangramsdeftangra.mswhois.msMontserratianawiki8tt..ms
tangsdeftan.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki5tt..gs
tangshandeftangsh.anwhois.anNetherlands Antillesianawiki8tt..an
tanguindeftangu.inwhois.inIndiaianawiki7tt..in
tangumdeftang.umwhois.umUnited States Minor Outlying Islandsianawiki6tt..um
tanguydeftang.uywhois.uyUruguayianawiki6tt..uy
tangydeftan.gywhois.gyGuyanaianawiki5tt..gy
tanhousedeftanhou.sewhois.seSwedenianawiki8tt..se
tanidefta.niwhois.niNicaraguaianawiki4tt..ni
taniaaustralisdeftaniaaustral.iswhois.isIcelandianawiki14tt..is
taniaborealisdeftaniaboreal.iswhois.isIcelandianawiki13tt..is
tanicadeftani.cawhois.caCanadaianawiki6tt..ca
tanierdeftani.erwhois.erEritreaianawiki6tt..er
tanisdeftan.iswhois.isIcelandianawiki5tt..is
tanistdeftani.stwhois.stSao Tome and Principeianawiki6tt..st
tanistriesdeftanistri.eswhois.esSpainianawiki10tt..es
tanitansydeftanitan.sywhois.sySyrian Arab Republicianawiki9tt..sy
tanjongdeftanjo.ngwhois.ngNigeriaianawiki7tt..ng
tanjoredeftanjo.rewhois.reReunion Islandianawiki7tt..re
tanjungpandandeftanjungpand.anwhois.anNetherlands Antillesianawiki13tt..an
tankagedeftanka.gewhois.geGeorgiaianawiki7tt..ge
tankagesdeftankag.eswhois.esSpainianawiki8tt..es
tankardbearerdeftankardbear.erwhois.erEritreaianawiki13tt..er
tankardbearingdeftankardbeari.ngwhois.ngNigeriaianawiki14tt..ng
tankasdeftank.aswhois.asAmerican Samoaianawiki6tt..as
tankcardeftankc.arwhois.arArgentinaianawiki7tt..ar
tankcircuitdeftankcircu.itwhois.itItalyianawiki11tt..it
tankcorpsdeftankcor.pswhois.psPalestinian Territory (Occupied)ianawiki9tt..ps
tankcorpsmandeftankcorpsm.anwhois.anNetherlands Antillesianawiki12tt..an
tankcrewmandeftankcrewm.anwhois.anNetherlands Antillesianawiki11tt..an
tankdestroyerdeftankdestroy.erwhois.erEritreaianawiki13tt..er
tankdramadeftankdra.mawhois.maMoroccoianawiki9tt..ma
tankdriverdeftankdriv.erwhois.erEritreaianawiki10tt..er
tankenginedeftankengi.newhois.neNigerianawiki10tt..ne
tankerdeftank.erwhois.erEritreaianawiki6tt..er
tankerabogusdeftankerabog.uswhois.usUnited Statesianawiki12tt..us
tankfarmingdeftankfarmi.ngwhois.ngNigeriaianawiki11tt..ng
tankfighterdeftankfight.erwhois.erEritreaianawiki11tt..er
tankfulsdeftankfu.lswhois.lsLesothoianawiki8tt..ls
tankiedeftank.iewhois.ieIrelandianawiki6tt..ie
tankingdeftanki.ngwhois.ngNigeriaianawiki7tt..ng
tanklikedeftankli.kewhois.keKenyaianawiki8tt..ke
tanklocomotivedeftanklocomoti.vewhois.veVenezuelaianawiki14tt..ve
tankmakerdeftankmak.erwhois.erEritreaianawiki9tt..er
tankmakingdeftankmaki.ngwhois.ngNigeriaianawiki10tt..ng
tankmandeftankm.anwhois.anNetherlands Antillesianawiki7tt..an
tankmeterdeftankmet.erwhois.erEritreaianawiki9tt..er
tankrivetdeftankriv.etwhois.etEthiopiaianawiki9tt..et
tankroomdeftankro.omwhois.omOmanianawiki8tt..om
tankrunnerdeftankrunn.erwhois.erEritreaianawiki10tt..er
tankshipsdeftankshi.pswhois.psPalestinian Territory (Occupied)ianawiki9tt..ps
tanksuitdeftanksu.itwhois.itItalyianawiki8tt..it
tanktrailerdeftanktrail.erwhois.erEritreaianawiki11tt..er
tanktruckdeftanktru.ckwhois.ckCook Islandsianawiki9tt..ck
tankwisedeftankwi.sewhois.seSwedenianawiki8tt..se
tanlingdeftanli.ngwhois.ngNigeriaianawiki7tt..ng
tannadeftan.nawhois.naNamibiaianawiki5tt..na
tannadardeftannad.arwhois.arArgentinaianawiki8tt..ar
tannagedeftanna.gewhois.geGeorgiaianawiki7tt..ge
tannagesdeftannag.eswhois.esSpainianawiki8tt..es
tannaimdeftanna.imwhois.imIsle of Manianawiki7tt..im
tannalbindeftannalb.inwhois.inIndiaianawiki9tt..in
tannasedeftanna.sewhois.seSwedenianawiki7tt..se
tannatesdeftannat.eswhois.esSpainianawiki8tt..es
tannenbaumdeftannenba.umwhois.umUnited States Minor Outlying Islandsianawiki10tt..um
tannerdeftann.erwhois.erEritreaianawiki6tt..er
tannerblishmachinedeftannerblishmachi.newhois.neNigerianawiki18tt..ne
tanneriesdeftanneri.eswhois.esSpainianawiki9tt..es
tanneryfungusdeftanneryfung.uswhois.usUnited Statesianawiki13tt..us
tannestdeftanne.stwhois.stSao Tome and Principeianawiki7tt..st
tannhauserdeftannhaus.erwhois.erEritreaianawiki10tt..er
tannhserdeftannhs.erwhois.erEritreaianawiki8tt..er
tannicaciddeftannicac.idwhois.idIndonesiaianawiki10tt..id
tanniddeftann.idwhois.idIndonesiaianawiki6tt..id
tannidedeftanni.dewhois.deGermanyianawiki7tt..de
tanniedeftann.iewhois.ieIrelandianawiki6tt..ie
tanniferousdeftannifero.uswhois.usUnited Statesianawiki11tt..us
tannindeftann.inwhois.inIndiaianawiki6tt..in
tanningdeftanni.ngwhois.ngNigeriaianawiki7tt..ng
tanningsdeftannin.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki8tt..gs
tanninlikedeftanninli.kewhois.keKenyaianawiki10tt..ke
tannishdeftanni.shwhois.shSaint Helenaianawiki7tt..sh
tannodeftan.nowhois.noNorwayianawiki5tt..no
tannogelatindeftannogelat.inwhois.inIndiaianawiki12tt..in
tannoiddeftanno.idwhois.idIndonesiaianawiki7tt..id
tannometerdeftannomet.erwhois.erEritreaianawiki10tt..er
tannutuvadeftannutu.vawhois.vaHoly See (Vatican City State)ianawiki9tt..va
tannutuvandeftannutuv.anwhois.anNetherlands Antillesianawiki10tt..an
tanodefta.nowhois.noNorwayianawiki4tt..no
tanoandeftano.anwhois.anNetherlands Antillesianawiki6tt..an
tanquamdeftanqu.amwhois.amArmeniaianawiki7tt..am
tanqueliniandeftanquelini.anwhois.anNetherlands Antillesianawiki12tt..an
tanrecdeftanr.ecwhois.ecEcuadorianawiki6tt..ec
tanrecsdeftanre.cswhois.csSerbia and Montenegroianawiki7tt..cs
tansiesdeftansi.eswhois.esSpainianawiki7tt..es
tansydeftan.sywhois.sySyrian Arab Republicianawiki5tt..sy
tansyoildeftansyo.ilwhois.ilIsraelianawiki8tt..il
tantadlindeftantadl.inwhois.inIndiaianawiki9tt..in
tantafflindeftantaffl.inwhois.inIndiaianawiki10tt..in
tantaleandeftantale.anwhois.anNetherlands Antillesianawiki9tt..an
tantaliandeftantali.anwhois.anNetherlands Antillesianawiki9tt..an
tantalicaciddeftantalicac.idwhois.idIndonesiaianawiki12tt..id
tantaliferousdeftantalifero.uswhois.usUnited Statesianawiki13tt..us
tantalifluoridedeftantalifluori.dewhois.deGermanyianawiki15tt..de
tantalisedeftantali.sewhois.seSwedenianawiki9tt..se
tantaliserdeftantalis.erwhois.erEritreaianawiki10tt..er
tantalisingdeftantalisi.ngwhois.ngNigeriaianawiki11tt..ng
tantalisinglydeftantalising.lywhois.lyLibyan Arab Jamahiriyaianawiki13tt..ly
tantalizerdeftantaliz.erwhois.erEritreaianawiki10tt..er
tantalizesdeftantaliz.eswhois.esSpainianawiki10tt..es
tantalizingdeftantalizi.ngwhois.ngNigeriaianawiki11tt..ng
tantalizinglydeftantalizing.lywhois.lyLibyan Arab Jamahiriyaianawiki13tt..ly
tantalofluoridedeftantalofluori.dewhois.deGermanyianawiki15tt..de
tantalousdeftantalo.uswhois.usUnited Statesianawiki9tt..us
tantalumdeftantal.umwhois.umUnited States Minor Outlying Islandsianawiki8tt..um
tantalumlampdeftantalumla.mpwhois.mpNorthern Mariana Islandsianawiki12tt..mp
tantalumsdeftantalu.mswhois.msMontserratianawiki9tt..ms
tantalusdeftantal.uswhois.usUnited Statesianawiki8tt..us
tantalusesdeftantalus.eswhois.esSpainianawiki10tt..es
tantandeftant.anwhois.anNetherlands Antillesianawiki6tt..an
tantarabobusdeftantarabob.uswhois.usUnited Statesianawiki12tt..us
tantarasdeftantar.aswhois.asAmerican Samoaianawiki8tt..as
tantiviesdeftantivi.eswhois.esSpainianawiki9tt..es
tantodeftan.towhois.toTongaianawiki5tt..to
tantpisdeftantp.iswhois.isIcelandianawiki7tt..is
tantrasdeftantr.aswhois.asAmerican Samoaianawiki7tt..as
tantrismdeftantri.smwhois.smSan Marinoianawiki8tt..sm
tantristdeftantri.stwhois.stSao Tome and Principeianawiki8tt..st
tantrumdeftantr.umwhois.umUnited States Minor Outlying Islandsianawiki7tt..um
tantrumsdeftantru.mswhois.msMontserratianawiki8tt..ms
tantsoitpeudeftantsoitp.euwhois.euEuropean Unionianawiki11tt..eu
tantumdeftant.umwhois.umUnited States Minor Outlying Islandsianawiki6tt..um
tanyoandeftanyo.anwhois.anNetherlands Antillesianawiki7tt..an
tanyourhidedeftanyourhi.dewhois.deGermanyianawiki11tt..de
tanystomatousdeftanystomato.uswhois.usUnited Statesianawiki13tt..us
tanzaniandeftanzani.anwhois.anNetherlands Antillesianawiki9tt..an
tanzinedeftanzi.newhois.neNigerianawiki7tt..ne
taodeft.aowhois.aoAngolaianawiki3tt..ao
taoismdeftaoi.smwhois.smSan Marinoianawiki6tt..sm
taoistdeftaoi.stwhois.stSao Tome and Principeianawiki6tt..st
taonurusdeftaonur.uswhois.usUnited Statesianawiki8tt..us
taotaideftaot.aiwhois.aiAnguillaianawiki6tt..ai
taotechingdeftaotechi.ngwhois.ngNigeriaianawiki10tt..ng
taotiehdeftaoti.ehwhois.ehWestern Saharaianawiki7tt..eh
taoyindeftaoy.inwhois.inIndiaianawiki6tt..in
tapadefta.pawhois.paPanamaianawiki4tt..pa
tapachuladeftapachu.lawhois.laLao People's Democratic Republicianawiki9tt..la
tapachultecadeftapachulte.cawhois.caCanadaianawiki12tt..ca
tapaclothdeftapaclo.thwhois.thThailandianawiki9tt..th
tapaderasdeftapader.aswhois.asAmerican Samoaianawiki9tt..as
tapaderodeftapade.rowhois.roRomaniaianawiki8tt..ro
tapajodeftapa.jowhois.joJordanianawiki6tt..jo
tapamakerdeftapamak.erwhois.erEritreaianawiki9tt..er
tapamakingdeftapamaki.ngwhois.ngNigeriaianawiki10tt..ng
tapasdeftap.aswhois.asAmerican Samoaianawiki5tt..as
tapasvideftapas.viwhois.viVirgin Islands, U.S.ianawiki7tt..vi
tapayaxindeftapayax.inwhois.inIndiaianawiki9tt..in
tapboltdeftapbo.ltwhois.ltLithuaniaianawiki7tt..lt
tapborerdeftapbor.erwhois.erEritreaianawiki8tt..er
tapchuckdeftapchu.ckwhois.ckCook Islandsianawiki8tt..ck
tapcinderdeftapcind.erwhois.erEritreaianawiki9tt..er
tapcutterdeftapcutt.erwhois.erEritreaianawiki9tt..er
tapdancerdeftapdanc.erwhois.erEritreaianawiki9tt..er
tapdancingdeftapdanci.ngwhois.ngNigeriaianawiki10tt..ng
tapdressingdeftapdressi.ngwhois.ngNigeriaianawiki11tt..ng
tapedefta.pewhois.pePeruianawiki4tt..pe
tapecartridgedeftapecartrid.gewhois.geGeorgiaianawiki13tt..ge
tapecopydeftapeco.pywhois.pyParaguayianawiki8tt..py
tapedeckdeftapede.ckwhois.ckCook Islandsianawiki8tt..ck
tapedprogramdeftapedprogr.amwhois.amArmeniaianawiki12tt..am
tapedrivesdeftapedriv.eswhois.esSpainianawiki10tt..es
tapegrassfamilydeftapegrassfami.lywhois.lyLibyan Arab Jamahiriyaianawiki15tt..ly
tapeinocephalismdeftapeinocephali.smwhois.smSan Marinoianawiki16tt..sm
tapeinocephalydeftapeinocepha.lywhois.lyLibyan Arab Jamahiriyaianawiki14tt..ly
tapelikedeftapeli.kewhois.keKenyaianawiki8tt..ke
tapelinedeftapeli.newhois.neNigerianawiki8tt..ne
tapelinesdeftapelin.eswhois.esSpainianawiki9tt..es
tapemachinedeftapemachi.newhois.neNigerianawiki11tt..ne
tapemakerdeftapemak.erwhois.erEritreaianawiki9tt..er
tapemakingdeftapemaki.ngwhois.ngNigeriaianawiki10tt..ng
tapemandeftapem.anwhois.anNetherlands Antillesianawiki7tt..an
tapemeasuredeftapemeasu.rewhois.reReunion Islandianawiki11tt..re
tapemovedeftapemo.vewhois.veVenezuelaianawiki8tt..ve
tapeplayerdeftapeplay.erwhois.erEritreaianawiki10tt..er
tapeprintingdeftapeprinti.ngwhois.ngNigeriaianawiki12tt..ng
taperdeftap.erwhois.erEritreaianawiki5tt..er
taperbearerdeftaperbear.erwhois.erEritreaianawiki11tt..er
tapereaderdeftaperead.erwhois.erEritreaianawiki10tt..er
tapereadingdeftapereadi.ngwhois.ngNigeriaianawiki11tt..ng
taperecorderdeftaperecord.erwhois.erEritreaianawiki12tt..er
taperecordingdeftaperecordi.ngwhois.ngNigeriaianawiki13tt..ng
taperedindeftapered.inwhois.inIndiaianawiki9tt..in
tapererdeftaper.erwhois.erEritreaianawiki7tt..er
tapergaugedeftapergau.gewhois.geGeorgiaianawiki10tt..ge
taperingdeftaperi.ngwhois.ngNigeriaianawiki8tt..ng
taperinglydeftapering.lywhois.lyLibyan Arab Jamahiriyaianawiki10tt..ly
taperjackdeftaperja.ckwhois.ckCook Islandsianawiki9tt..ck
taperlydeftaper.lywhois.lyLibyan Arab Jamahiriyaianawiki7tt..ly
tapermakerdeftapermak.erwhois.erEritreaianawiki10tt..er
tapermakingdeftapermaki.ngwhois.ngNigeriaianawiki11tt..ng
taperpindeftaperp.inwhois.inIndiaianawiki8tt..in
taperpipethreaddeftaperpipethre.adwhois.adAndorraianawiki15tt..ad
taperreamerdeftaperream.erwhois.erEritreaianawiki11tt..er
taperreducersleevedeftaperreducerslee.vewhois.veVenezuelaianawiki18tt..ve
taperstickdeftapersti.ckwhois.ckCook Islandsianawiki10tt..ck
tapertoapointdeftapertoapo.intwhois.intInternational Organizationsianawiki13tt..int
taperwisedeftaperwi.sewhois.seSwedenianawiki9tt..se
tapesdeftap.eswhois.esSpainianawiki5tt..es
tapesiumdeftapesi.umwhois.umUnited States Minor Outlying Islandsianawiki8tt..um
tapesizerdeftapesiz.erwhois.erEritreaianawiki9tt..er
tapesizingdeftapesizi.ngwhois.ngNigeriaianawiki10tt..ng
tapeslashingdeftapeslashi.ngwhois.ngNigeriaianawiki12tt..ng
tapesterdeftapest.erwhois.erEritreaianawiki8tt..er
tapestriesdeftapestri.eswhois.esSpainianawiki10tt..es
tapestringdeftapestri.ngwhois.ngNigeriaianawiki10tt..ng
tapestrybrusselsdeftapestrybrusse.lswhois.lsLesothoianawiki16tt..ls
tapestrycarpetdeftapestrycarp.etwhois.etEthiopiaianawiki14tt..et
tapestryingdeftapestryi.ngwhois.ngNigeriaianawiki11tt..ng
tapestrylikedeftapestryli.kewhois.keKenyaianawiki12tt..ke
tapestrymakerdeftapestrymak.erwhois.erEritreaianawiki13tt..er
tapestrymakingdeftapestrymaki.ngwhois.ngNigeriaianawiki14tt..ng
tapestrymothdeftapestrymo.thwhois.thThailandianawiki12tt..th
tapestrypaintingdeftapestrypainti.ngwhois.ngNigeriaianawiki16tt..ng
tapestrystitchdeftapestrystit.chwhois.chSwitzerlandianawiki14tt..ch
tapestryweaverdeftapestryweav.erwhois.erEritreaianawiki14tt..er
tapestryweavingdeftapestryweavi.ngwhois.ngNigeriaianawiki15tt..ng
tapetdeftap.etwhois.etEthiopiaianawiki5tt..et
tapetaldeftapet.alwhois.alAlbaniaianawiki7tt..al
tapethermometerdeftapethermomet.erwhois.erEritreaianawiki15tt..er
tapetisdeftapet.iswhois.isIcelandianawiki7tt..is
tapetumdeftapet.umwhois.umUnited States Minor Outlying Islandsianawiki7tt..um
tapetyingdeftapetyi.ngwhois.ngNigeriaianawiki9tt..ng
tapewormsdeftapewor.mswhois.msMontserratianawiki9tt..ms
tapgaugedeftapgau.gewhois.geGeorgiaianawiki8tt..ge
tapgrinderdeftapgrind.erwhois.erEritreaianawiki10tt..er
taphiaedeftaphi.aewhois.aeUnited Arab Emiratesianawiki7tt..ae
tapholderdeftaphold.erwhois.erEritreaianawiki9tt..er
tapholesdeftaphol.eswhois.esSpainianawiki8tt..es
taphosedeftapho.sewhois.seSwedenianawiki7tt..se
taphousedeftaphou.sewhois.seSwedenianawiki8tt..se
taphousesdeftaphous.eswhois.esSpainianawiki9tt..es
taphrinadeftaphri.nawhois.naNamibiaianawiki8tt..na
taphrinaceaedeftaphrinace.aewhois.aeUnited Arab Emiratesianawiki12tt..ae
tapiderodeftapide.rowhois.roRomaniaianawiki8tt..ro
tapijulapanedeftapijulapa.newhois.neNigerianawiki12tt..ne
tapinceophalismdeftapinceophali.smwhois.smSan Marinoianawiki15tt..sm
tapingdeftapi.ngwhois.ngNigeriaianawiki6tt..ng
tapingpindeftapingp.inwhois.inIndiaianawiki9tt..in
tapingsdeftapin.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki7tt..gs
tapinocephalydeftapinocepha.lywhois.lyLibyan Arab Jamahiriyaianawiki13tt..ly
tapinomadeftapino.mawhois.maMoroccoianawiki8tt..ma
tapinophobydeftapinopho.bywhois.byBelarusianawiki11tt..by
tapinosisdeftapinos.iswhois.isIcelandianawiki9tt..is
tapiocadeftapio.cawhois.caCanadaianawiki7tt..ca
tapiocapuddingdeftapiocapuddi.ngwhois.ngNigeriaianawiki14tt..ng
tapiocasdeftapioc.aswhois.asAmerican Samoaianawiki8tt..as
tapirdeftap.irwhois.irIran, Islamic Republic ofianawiki5tt..ir
tapiridaedeftapirid.aewhois.aeUnited Arab Emiratesianawiki9tt..ae
tapiridiandeftapiridi.anwhois.anNetherlands Antillesianawiki10tt..an
tapirinedeftapiri.newhois.neNigerianawiki8tt..ne
tapirmouthdeftapirmou.thwhois.thThailandianawiki10tt..th
tapirodeftapi.rowhois.roRomaniaianawiki6tt..ro
tapiroiddeftapiro.idwhois.idIndonesiaianawiki8tt..id
tapirusdeftapir.uswhois.usUnited Statesianawiki7tt..us
tapisdeftap.iswhois.isIcelandianawiki5tt..is
tapiserdeftapis.erwhois.erEritreaianawiki7tt..er
tapisesdeftapis.eswhois.esSpainianawiki7tt..es
tapismdeftapi.smwhois.smSan Marinoianawiki6tt..sm
tapisserdeftapiss.erwhois.erEritreaianawiki8tt..er
tapisseriedeftapisser.iewhois.ieIrelandianawiki10tt..ie
tapissierdeftapissi.erwhois.erEritreaianawiki9tt..er
tapistdeftapi.stwhois.stSao Tome and Principeianawiki6tt..st
tapitdeftap.itwhois.itItalyianawiki5tt..it
taplashdeftapla.shwhois.shSaint Helenaianawiki7tt..sh
tapletdeftapl.etwhois.etEthiopiaianawiki6tt..et
tapleyismdeftapleyi.smwhois.smSan Marinoianawiki9tt..sm
taplindeftapl.inwhois.inIndiaianawiki6tt..in
taplinedeftapli.newhois.neNigerianawiki7tt..ne
taplingdeftapli.ngwhois.ngNigeriaianawiki7tt..ng
tapmostdeftapmo.stwhois.stSao Tome and Principeianawiki7tt..st
tapnetdeftapn.etwhois.etEthiopiaianawiki6tt..et
tapnetdeftap.netwhois.netNetworksianawiki6tt..net
tapocodeftapo.cowhois.coColombiaianawiki6tt..co
taposadeftapo.sawhois.saSaudi Arabiaianawiki6tt..sa
tapouttherhythmdeftapouttherhyt.hmwhois.hmHeard and McDonald Islandsianawiki15tt..hm
tappadeftap.pawhois.paPanamaianawiki5tt..pa
tappahannockdeftappahanno.ckwhois.ckCook Islandsianawiki12tt..ck
tappandeftapp.anwhois.anNetherlands Antillesianawiki6tt..an
tappedjointdeftappedjo.intwhois.intInternational Organizationsianawiki11tt..int
tapperdeftapp.erwhois.erEritreaianawiki6tt..er
tappererdeftapper.erwhois.erEritreaianawiki8tt..er
tappertitiandeftappertiti.anwhois.anNetherlands Antillesianawiki12tt..an
tappetdeftapp.etwhois.etEthiopiaianawiki6tt..et
tappetwrenchdeftappetwren.chwhois.chSwitzerlandianawiki12tt..ch
tappietooriedeftappietoor.iewhois.ieIrelandianawiki12tt..ie
tappingdeftappi.ngwhois.ngNigeriaianawiki7tt..ng
tappingchuckdeftappingchu.ckwhois.ckCook Islandsianawiki12tt..ck
tappingsdeftappin.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki8tt..gs
tappishdeftappi.shwhois.shSaint Helenaianawiki7tt..sh
tappitdeftapp.itwhois.itItalyianawiki6tt..it
tapreamerdeftapream.erwhois.erEritreaianawiki9tt..er
taprivetdeftapriv.etwhois.etEthiopiaianawiki8tt..et
taprobanedeftaproba.newhois.neNigerianawiki9tt..ne
taproomdeftapro.omwhois.omOmanianawiki7tt..om
taproomsdeftaproo.mswhois.msMontserratianawiki8tt..ms
taprootdeftap.rootwhois.rootRoot Server InfrastructureN/Awiki7tt..root
tapsdefta.pswhois.psPalestinian Territory (Occupied)ianawiki4tt..ps
tapsalteeriedeftapsalteer.iewhois.ieIrelandianawiki12tt..ie
tapsieteeriedeftapsieteer.iewhois.ieIrelandianawiki12tt..ie
tapsmandeftapsm.anwhois.anNetherlands Antillesianawiki7tt..an
tapsterdeftapst.erwhois.erEritreaianawiki7tt..er
tapsterlikedeftapsterli.kewhois.keKenyaianawiki11tt..ke
tapsterlydeftapster.lywhois.lyLibyan Arab Jamahiriyaianawiki9tt..ly
tapuyandeftapuy.anwhois.anNetherlands Antillesianawiki7tt..an
tapwaterdeftapwat.erwhois.erEritreaianawiki8tt..er
tapwrenchdeftapwren.chwhois.chSwitzerlandianawiki9tt..ch
taqliddeftaql.idwhois.idIndonesiaianawiki6tt..id
taquadeftaq.uawhois.uaUkraineianawiki5tt..ua
tardeft.arwhois.arArgentinaianawiki3tt..ar
tarabardeftarab.arwhois.arArgentinaianawiki7tt..ar
tarabuluseshshamdeftarabuluseshsh.amwhois.amArmeniaianawiki16tt..am
taracahitiandeftaracahiti.anwhois.anNetherlands Antillesianawiki12tt..an
taraciddeftarac.idwhois.idIndonesiaianawiki7tt..id
tarafdeftar.afwhois.afAfghanistanianawiki5tt..af
tarafdardeftarafd.arwhois.arArgentinaianawiki8tt..ar
taragedeftara.gewhois.geGeorgiaianawiki6tt..ge
tarahumardeftarahum.arwhois.arArgentinaianawiki9tt..ar
tarahumaredeftarahuma.rewhois.reReunion Islandianawiki10tt..re
taraideftar.aiwhois.aiAnguillaianawiki5tt..ai
taramadeftara.mawhois.maMoroccoianawiki6tt..ma
taramasdeftaram.aswhois.asAmerican Samoaianawiki7tt..as
taramembedeftaramem.bewhois.beBelgiumianawiki9tt..be
tarandeftar.anwhois.anNetherlands Antillesianawiki5tt..an
tarandeandeftarande.anwhois.anNetherlands Antillesianawiki9tt..an
tarandfeatherdeftarandfeath.erwhois.erEritreaianawiki13tt..er
tarandfeatheringdeftarandfeatheri.ngwhois.ngNigeriaianawiki16tt..ng
tarandiandeftarandi.anwhois.anNetherlands Antillesianawiki9tt..an
taranisdeftaran.iswhois.isIcelandianawiki7tt..is
tarantasdeftarant.aswhois.asAmerican Samoaianawiki8tt..as
tarantasesdeftarantas.eswhois.esSpainianawiki10tt..es
tarantelladeftarantel.lawhois.laLao People's Democratic Republicianawiki10tt..la
tarantismdeftaranti.smwhois.smSan Marinoianawiki9tt..sm
tarantistdeftaranti.stwhois.stSao Tome and Principeianawiki9tt..st
tarantodeftaran.towhois.toTongaianawiki7tt..to
tarantuladeftarantu.lawhois.laLao People's Democratic Republicianawiki9tt..la
tarantulaedeftarantul.aewhois.aeUnited Arab Emiratesianawiki10tt..ae
tarantulanebuladeftarantulanebu.lawhois.laLao People's Democratic Republicianawiki15tt..la
tarantulardeftarantul.arwhois.arArgentinaianawiki10tt..ar
tarantulasdeftarantul.aswhois.asAmerican Samoaianawiki10tt..as
tarantuliddeftarantul.idwhois.idIndonesiaianawiki10tt..id
tarantulidaedeftarantulid.aewhois.aeUnited Arab Emiratesianawiki12tt..ae
tarantulismdeftarantuli.smwhois.smSan Marinoianawiki11tt..sm
tarantulousdeftarantulo.uswhois.usUnited Statesianawiki11tt..us
tarapatchdeftarapat.chwhois.chSwitzerlandianawiki9tt..ch
taraphdeftara.phwhois.phPhilippinesianawiki6tt..ph
tarapindeftarap.inwhois.inIndiaianawiki7tt..in
tarapotodeftarapo.towhois.toTongaianawiki8tt..to
tarasbulbadeftarasbul.bawhois.baBosnia and Herzegovinaianawiki10tt..ba
tarascdeftara.scwhois.scSeychellesianawiki6tt..sc
tarascandeftarasc.anwhois.anNetherlands Antillesianawiki8tt..an
tarascodeftaras.cowhois.coColombiaianawiki7tt..co
tarascodeftara.scowhois.scoScots languageN/Awiki7tt..sco
tarassisdeftarass.iswhois.isIcelandianawiki8tt..is
taraudeftar.auwhois.auAustraliaianawiki5tt..au
tarawamakindeftarawamak.inwhois.inIndiaianawiki11tt..in
taraxacerindeftaraxacer.inwhois.inIndiaianawiki11tt..in
taraxacindeftaraxac.inwhois.inIndiaianawiki9tt..in
taraxacumdeftaraxac.umwhois.umUnited States Minor Outlying Islandsianawiki9tt..um
tarbabydeftarba.bywhois.byBelarusianawiki7tt..by
tarbagandeftarbag.anwhois.anNetherlands Antillesianawiki8tt..an
tarbasedeftarba.sewhois.seSwedenianawiki7tt..se
tarbesdeftarb.eswhois.esSpainianawiki6tt..es
tarbetdeftarb.etwhois.etEthiopiaianawiki6tt..et
tarblackdeftarbla.ckwhois.ckCook Islandsianawiki8tt..ck
tarbogandeftarbog.anwhois.anNetherlands Antillesianawiki8tt..an
tarboggindeftarbogg.inwhois.inIndiaianawiki9tt..in
tarboilingdeftarboili.ngwhois.ngNigeriaianawiki10tt..ng
tarbooshdeftarboo.shwhois.shSaint Helenaianawiki8tt..sh
tarbooshesdeftarboosh.eswhois.esSpainianawiki10tt..es
tarborodeftarbo.rowhois.roRomaniaianawiki7tt..ro
tarbrushdeftarbru.shwhois.shSaint Helenaianawiki8tt..sh
tarbucketdeftarbuck.etwhois.etEthiopiaianawiki9tt..et
tarburningdeftarburni.ngwhois.ngNigeriaianawiki10tt..ng
tarbushdeftarbu.shwhois.shSaint Helenaianawiki7tt..sh
tarbushesdeftarbush.eswhois.esSpainianawiki9tt..es
tarcancerdeftarcanc.erwhois.erEritreaianawiki9tt..er
tarcoaldeftarco.alwhois.alAlbaniaianawiki7tt..al
tardandodeftardan.dowhois.doDominican Republicianawiki8tt..do
tardedeftar.dewhois.deGermanyianawiki5tt..de
tardenoisiandeftardenoisi.anwhois.anNetherlands Antillesianawiki12tt..an
tardierdeftardi.erwhois.erEritreaianawiki7tt..er
tardiesdeftardi.eswhois.esSpainianawiki7tt..es
tardiestdeftardie.stwhois.stSao Tome and Principeianawiki8tt..st
tardieudeftardi.euwhois.euEuropean Unionianawiki7tt..eu
tardigradedeftardigra.dewhois.deGermanyianawiki10tt..de
tardigradousdeftardigrado.uswhois.usUnited Statesianawiki12tt..us
tardiloquousdeftardiloquo.uswhois.usUnited Statesianawiki12tt..us
tardiloquydeftardiloq.uywhois.uyUruguayianawiki10tt..uy
tardilydeftardi.lywhois.lyLibyan Arab Jamahiriyaianawiki7tt..ly
tardistillerdeftardistill.erwhois.erEritreaianawiki12tt..er
tarditudedeftarditu.dewhois.deGermanyianawiki9tt..de
tardivedeftardi.vewhois.veVenezuelaianawiki7tt..ve
tardodeftar.dowhois.doDominican Republicianawiki5tt..do
tardrumdeftardr.umwhois.umUnited States Minor Outlying Islandsianawiki7tt..um
tardyepilepsydeftardyepilep.sywhois.sySyrian Arab Republicianawiki13tt..sy
tardymovingdeftardymovi.ngwhois.ngNigeriaianawiki11tt..ng
tardyrisingdeftardyrisi.ngwhois.ngNigeriaianawiki11tt..ng
taredefta.rewhois.reReunion Islandianawiki4tt..re
tareanagesdeftareanag.eswhois.esSpainianawiki10tt..es
tarefitchdeftarefit.chwhois.chSwitzerlandianawiki9tt..ch
tarentaladeftarenta.lawhois.laLao People's Democratic Republicianawiki9tt..la
tarentinedeftarenti.newhois.neNigerianawiki9tt..ne
tarentismdeftarenti.smwhois.smSan Marinoianawiki9tt..sm
tarentoladeftarento.lawhois.laLao People's Democratic Republicianawiki9tt..la
tarentumdeftarent.umwhois.umUnited States Minor Outlying Islandsianawiki8tt..um
tarepatchdeftarepat.chwhois.chSwitzerlandianawiki9tt..ch
tareroomdeftarero.omwhois.omOmanianawiki8tt..om
taresdeftar.eswhois.esSpainianawiki5tt..es
tarevetchdeftarevet.chwhois.chSwitzerlandianawiki9tt..ch
tarflowerdeftarflow.erwhois.erEritreaianawiki9tt..er
targedeftar.gewhois.geGeorgiaianawiki5tt..ge
targemandeftargem.anwhois.anNetherlands Antillesianawiki8tt..an
targerdeftarg.erwhois.erEritreaianawiki6tt..er
targesdeftarg.eswhois.esSpainianawiki6tt..es
targetdeftarg.etwhois.etEthiopiaianawiki6tt..et
targetboatdeftargetbo.atwhois.atAustriaianawiki10tt..at
targeteerdeftargete.erwhois.erEritreaianawiki9tt..er
targetierdeftargeti.erwhois.erEritreaianawiki9tt..er
targetimagedeftargetima.gewhois.geGeorgiaianawiki11tt..ge
targetingdeftargeti.ngwhois.ngNigeriaianawiki9tt..ng
targetlampdeftargetla.mpwhois.mpNorthern Mariana Islandsianawiki10tt..mp
targetlanguagedeftargetlangua.gewhois.geGeorgiaianawiki14tt..ge
targetlikedeftargetli.kewhois.keKenyaianawiki10tt..ke
targetmandeftargetm.anwhois.anNetherlands Antillesianawiki9tt..an
targetmeetingdeftargetmeeti.ngwhois.ngNigeriaianawiki13tt..ng
targetplanetdeftargetplan.etwhois.etEthiopiaianawiki12tt..et
targetplanetdeftargetpla.netwhois.netNetworksianawiki12tt..net
targetrangedeftargetran.gewhois.geGeorgiaianawiki11tt..ge
targetshooterdeftargetshoot.erwhois.erEritreaianawiki13tt..er
targettdeftarge.ttwhois.ttTrinidad and Tobagoianawiki7tt..tt
targettowerdeftargettow.erwhois.erEritreaianawiki11tt..er
targettugdeftargett.ugwhois.ugUgandaianawiki9tt..ug
targetvaluesdeftargetvalu.eswhois.esSpainianawiki12tt..es
targheedeftargh.eewhois.eeEstoniaianawiki7tt..ee
targingdeftargi.ngwhois.ngNigeriaianawiki7tt..ng
targitausdeftargita.uswhois.usUnited Statesianawiki9tt..us
targualphabetdeftargualphab.etwhois.etEthiopiaianawiki13tt..et
targumdeftarg.umwhois.umUnited States Minor Outlying Islandsianawiki6tt..um
targumicaldeftargumic.alwhois.alAlbaniaianawiki10tt..al
targumistdeftargumi.stwhois.stSao Tome and Principeianawiki9tt..st
targumsdeftargu.mswhois.msMontserratianawiki7tt..ms
tarheatingdeftarheati.ngwhois.ngNigeriaianawiki10tt..ng
tarheelerdeftarheel.erwhois.erEritreaianawiki9tt..er
tarianadeftaria.nawhois.naNamibiaianawiki7tt..na
tariedeftar.iewhois.ieIrelandianawiki5tt..ie
tariffingdeftariffi.ngwhois.ngNigeriaianawiki9tt..ng
tariffismdeftariffi.smwhois.smSan Marinoianawiki9tt..sm
tariffistdeftariffi.stwhois.stSao Tome and Principeianawiki9tt..st
tarifflawdeftariffl.awwhois.awArubaianawiki9tt..aw
tariffmakerdeftariffmak.erwhois.erEritreaianawiki11tt..er
tariffmakingdeftariffmaki.ngwhois.ngNigeriaianawiki12tt..ng
tariffraisingdeftariffraisi.ngwhois.ngNigeriaianawiki13tt..ng
tariffreformerdeftariffreform.erwhois.erEritreaianawiki14tt..er
tariffregulatingdeftariffregulati.ngwhois.ngNigeriaianawiki16tt..ng
tarifftinkeringdeftarifftinkeri.ngwhois.ngNigeriaianawiki15tt..ng
tariffwisedeftariffwi.sewhois.seSwedenianawiki10tt..se
tarikbenhabilesdeftarikbenhabil.eswhois.esSpainianawiki15tt..es
tarimdeftar.imwhois.imIsle of Manianawiki5tt..im
tarimbasindeftarimbas.inwhois.inIndiaianawiki10tt..in
tarindeftar.inwhois.inIndiaianawiki5tt..in
taringdeftari.ngwhois.ngNigeriaianawiki6tt..ng
tariqadeftari.qawhois.qaQatarianawiki6tt..qa
tariqatdeftariq.atwhois.atAustriaianawiki7tt..at
tarishdeftari.shwhois.shSaint Helenaianawiki6tt..sh
tarkalanideftarkala.niwhois.niNicaraguaianawiki9tt..ni
tarkanideftarka.niwhois.niNicaraguaianawiki7tt..ni
tarkeeandeftarkee.anwhois.anNetherlands Antillesianawiki8tt..an
tarkhandeftarkh.anwhois.anNetherlands Antillesianawiki7tt..an
tarkiodeftark.iowhois.ioBritish Indian Ocean Territoryianawiki6tt..io
tarlacdeftarl.acwhois.acAscension Islandianawiki6tt..ac
tarlaiddeftarla.idwhois.idIndonesiaianawiki7tt..id
tarlatandeftarlat.anwhois.anNetherlands Antillesianawiki8tt..an
tarleatherdeftarleath.erwhois.erEritreaianawiki10tt..er
tarletandeftarlet.anwhois.anNetherlands Antillesianawiki8tt..an
tarliesdeftarli.eswhois.esSpainianawiki7tt..es
tarlikedeftarli.kewhois.keKenyaianawiki7tt..ke
tarmacdeftarm.acwhois.acAscension Islandianawiki6tt..ac
tarmacadamdeftarmacad.amwhois.amArmeniaianawiki10tt..am
tarmacsdeftarma.cswhois.csSerbia and Montenegroianawiki7tt..cs
tarmandeftarm.anwhois.anNetherlands Antillesianawiki6tt..an
tarnaldeftarn.alwhois.alAlbaniaianawiki6tt..al
tarnallydeftarnal.lywhois.lyLibyan Arab Jamahiriyaianawiki8tt..ly
tarnedeftar.newhois.neNigerianawiki5tt..ne
tarnetgaronnedeftarnetgaron.newhois.neNigerianawiki13tt..ne
tarnishdeftarni.shwhois.shSaint Helenaianawiki7tt..sh
tarnisherdeftarnish.erwhois.erEritreaianawiki9tt..er
tarnishesdeftarnish.eswhois.esSpainianawiki9tt..es
tarnishingdeftarnishi.ngwhois.ngNigeriaianawiki10tt..ng
tarnkappedeftarnkap.pewhois.pePeruianawiki9tt..pe
tarnlikedeftarnli.kewhois.keKenyaianawiki8tt..ke
tarnsidedeftarnsi.dewhois.deGermanyianawiki8tt..de
tarnumberdeftarnumb.erwhois.erEritreaianawiki9tt..er
tarodefta.rowhois.roRomaniaianawiki4tt..ro
taroccodeftaroc.cowhois.coColombiaianawiki7tt..co
tarocsdeftaro.cswhois.csSerbia and Montenegroianawiki6tt..cs
tarogatodeftaroga.towhois.toTongaianawiki8tt..to
taroildeftaro.ilwhois.ilIsraelianawiki6tt..il
taropatchdeftaropat.chwhois.chSwitzerlandianawiki9tt..ch
tarpaintdeftarpa.intwhois.intInternational Organizationsianawiki8tt..int
tarpandeftarp.anwhois.anNetherlands Antillesianawiki6tt..an
tarpaperdeftarpap.erwhois.erEritreaianawiki8tt..er
tarpauliandeftarpauli.anwhois.anNetherlands Antillesianawiki10tt..an
tarpaulindeftarpaul.inwhois.inIndiaianawiki9tt..in
tarpaulinmakerdeftarpaulinmak.erwhois.erEritreaianawiki14tt..er
tarpaulinmusterdeftarpaulinmust.erwhois.erEritreaianawiki15tt..er
tarpeiandeftarpei.anwhois.anNetherlands Antillesianawiki8tt..an
tarpeianrockdeftarpeianro.ckwhois.ckCook Islandsianawiki12tt..ck
tarponspringsdeftarponsprin.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki13tt..gs
tarpsdeftar.pswhois.psPalestinian Territory (Occupied)ianawiki5tt..ps
tarpumdeftarp.umwhois.umUnited States Minor Outlying Islandsianawiki6tt..um
tarquindeftarqu.inwhois.inIndiaianawiki7tt..in
tarquinishdeftarquini.shwhois.shSaint Helenaianawiki10tt..sh
tarrabadeftarra.bawhois.baBosnia and Herzegovinaianawiki7tt..ba
tarrackdeftarra.ckwhois.ckCook Islandsianawiki7tt..ck
tarradiddlerdeftarradiddl.erwhois.erEritreaianawiki12tt..er
tarragonadeftarrago.nawhois.naNamibiaianawiki9tt..na
tarragonoildeftarragono.ilwhois.ilIsraelianawiki11tt..il
tarragonvinegardeftarragonvineg.arwhois.arArgentinaianawiki15tt..ar
tarrasdeftarr.aswhois.asAmerican Samoaianawiki6tt..as
tarrasadeftarra.sawhois.saSaudi Arabiaianawiki7tt..sa
tarratinedeftarrati.newhois.neNigerianawiki9tt..ne
tarredeftar.rewhois.reReunion Islandianawiki5tt..re
tarredwiththesamebrushdeftarredwiththesamebru.shwhois.shSaint Helenaianawiki22tt..sh
tarremovingdeftarremovi.ngwhois.ngNigeriaianawiki11tt..ng
tarrerdeftarr.erwhois.erEritreaianawiki6tt..er
tarresdeftarr.eswhois.esSpainianawiki6tt..es
tarriedeftarr.iewhois.ieIrelandianawiki6tt..ie
tarrierdeftarri.erwhois.erEritreaianawiki7tt..er
tarriesdeftarri.eswhois.esSpainianawiki7tt..es
tarriestdeftarrie.stwhois.stSao Tome and Principeianawiki8tt..st
tarrilydeftarri.lywhois.lyLibyan Arab Jamahiriyaianawiki7tt..ly
tarringdeftarri.ngwhois.ngNigeriaianawiki7tt..ng
tarrishdeftarri.shwhois.shSaint Helenaianawiki7tt..sh
tarrockdeftarro.ckwhois.ckCook Islandsianawiki7tt..ck
tarrsusdeftarrs.uswhois.usUnited Statesianawiki7tt..us
tarryiestdeftarryie.stwhois.stSao Tome and Principeianawiki9tt..st
tarryingdeftarryi.ngwhois.ngNigeriaianawiki8tt..ng
tarryinglydeftarrying.lywhois.lyLibyan Arab Jamahiriyaianawiki10tt..ly
tarryjacketdeftarryjack.etwhois.etEthiopiaianawiki11tt..et
tarryjohndeftarryjo.hnwhois.hnHondurasianawiki9tt..hn
tarsadenitisdeftarsadenit.iswhois.isIcelandianawiki12tt..is
tarsaldeftars.alwhois.alAlbaniaianawiki6tt..al
tarsalsdeftarsa.lswhois.lsLesothoianawiki7tt..ls
tarsedeftar.sewhois.seSwedenianawiki5tt..se
tarsectomydeftarsecto.mywhois.myMalaysiaianawiki10tt..my
tarshishdeftarshi.shwhois.shSaint Helenaianawiki8tt..sh
tarsideftar.siwhois.siSloveniaianawiki5tt..si
tarsiasdeftarsi.aswhois.asAmerican Samoaianawiki7tt..as
tarsierdeftarsi.erwhois.erEritreaianawiki7tt..er
tarsiidaedeftarsiid.aewhois.aeUnited Arab Emiratesianawiki9tt..ae
tarsioiddeftarsio.idwhois.idIndonesiaianawiki8tt..id
tarsipedidaedeftarsipedid.aewhois.aeUnited Arab Emiratesianawiki12tt..ae
tarsipedinaedeftarsipedin.aewhois.aeUnited Arab Emiratesianawiki12tt..ae
tarsipesdeftarsip.eswhois.esSpainianawiki8tt..es
tarsitisdeftarsit.iswhois.isIcelandianawiki8tt..is
tarsiusdeftarsi.uswhois.usUnited Statesianawiki7tt..us
tarskideftars.kiwhois.kiKiribatiianawiki6tt..ki
tarsodeftar.sowhois.soSomaliaianawiki5tt..so
tarsoclasisdeftarsoclas.iswhois.isIcelandianawiki11tt..is
tarsometatarsaldeftarsometatars.alwhois.alAlbaniaianawiki15tt..al
tarsometatarsideftarsometatar.siwhois.siSloveniaianawiki14tt..si
tarsometatarsusdeftarsometatars.uswhois.usUnited Statesianawiki15tt..us
tarsonemiddeftarsonem.idwhois.idIndonesiaianawiki10tt..id
tarsonemidaedeftarsonemid.aewhois.aeUnited Arab Emiratesianawiki12tt..ae
tarsonemusdeftarsonem.uswhois.usUnited Statesianawiki10tt..us
tarsoorbitaldeftarsoorbit.alwhois.alAlbaniaianawiki12tt..al
tarsophalangealdeftarsophalange.alwhois.alAlbaniaianawiki15tt..al
tarsophymadeftarsophy.mawhois.maMoroccoianawiki10tt..ma
tarsoplasiadeftarsopl.asiawhois.asiaDotAsia OrganizationN/Awiki11tt..asia
tarsoptosisdeftarsoptos.iswhois.isIcelandianawiki11tt..is
tarsotarsaldeftarsotars.alwhois.alAlbaniaianawiki11tt..al
tarsotibaldeftarsotib.alwhois.alAlbaniaianawiki10tt..al
tarsotomydeftarsoto.mywhois.myMalaysiaianawiki9tt..my
tarsprayerdeftarspray.erwhois.erEritreaianawiki10tt..er
tarsusdeftars.uswhois.usUnited Statesianawiki6tt..us
tartandeftart.anwhois.anNetherlands Antillesianawiki6tt..an
tartanadeftarta.nawhois.naNamibiaianawiki7tt..na
tartanasdeftartan.aswhois.asAmerican Samoaianawiki8tt..as
tartanedeftarta.newhois.neNigerianawiki7tt..ne
tartanvelvetdeftartanvelv.etwhois.etEthiopiaianawiki12tt..et
tartardeftart.arwhois.arArgentinaianawiki6tt..ar
tartaredeftarta.rewhois.reReunion Islandianawiki7tt..re
tartareandeftartare.anwhois.anNetherlands Antillesianawiki9tt..an
tartareousdeftartareo.uswhois.usUnited Statesianawiki10tt..us
tartaretdeftartar.etwhois.etEthiopiaianawiki8tt..et
tartarhorsedeftartarhor.sewhois.seSwedenianawiki11tt..se
tartariandeftartari.anwhois.anNetherlands Antillesianawiki9tt..an
tartarianasterdeftartarianast.erwhois.erEritreaianawiki14tt..er
tartaricaciddeftartaricac.idwhois.idIndonesiaianawiki12tt..id
tartarindeftartar.inwhois.inIndiaianawiki8tt..in
tartarinedeftartari.newhois.neNigerianawiki9tt..ne
tartarishdeftartari.shwhois.shSaint Helenaianawiki9tt..sh
tartarismdeftartari.smwhois.smSan Marinoianawiki9tt..sm
tartarizingdeftartarizi.ngwhois.ngNigeriaianawiki11tt..ng
tartarlikedeftartarli.kewhois.keKenyaianawiki10tt..ke
tartarlydeftartar.lywhois.lyLibyan Arab Jamahiriyaianawiki8tt..ly
tartarologydeftartarolo.gywhois.gyGuyanaianawiki11tt..gy
tartarousdeftartaro.uswhois.usUnited Statesianawiki9tt..us
tartarumdeftartar.umwhois.umUnited States Minor Outlying Islandsianawiki8tt..um
tartarusdeftartar.uswhois.usUnited Statesianawiki8tt..us
tartaryeastdeftartaryea.stwhois.stSao Tome and Principeianawiki11tt..st
tarterdeftart.erwhois.erEritreaianawiki6tt..er
tartestdeftarte.stwhois.stSao Tome and Principeianawiki7tt..st
tartestdeftar.testwhois.testPrivate TestingN/Awiki7tt..test
tartinedeftarti.newhois.neNigerianawiki7tt..ne
tartingdeftarti.ngwhois.ngNigeriaianawiki7tt..ng
tartinideftarti.niwhois.niNicaraguaianawiki7tt..ni
tartishdeftarti.shwhois.shSaint Helenaianawiki7tt..sh
tartishlydeftartish.lywhois.lyLibyan Arab Jamahiriyaianawiki9tt..ly
tartletdeftartl.etwhois.etEthiopiaianawiki7tt..et
tartlydeftart.lywhois.lyLibyan Arab Jamahiriyaianawiki6tt..ly
tartnessesdeftartness.eswhois.esSpainianawiki10tt..es
tartramiddeftartram.idwhois.idIndonesiaianawiki9tt..id
tartramidedeftartrami.dewhois.deGermanyianawiki10tt..de
tartratesdeftartrat.eswhois.esSpainianawiki9tt..es
tartrazindeftartraz.inwhois.inIndiaianawiki9tt..in
tartrazinedeftartrazi.newhois.neNigerianawiki10tt..ne
tartrodeftart.rowhois.roRomaniaianawiki6tt..ro
tartrousdeftartro.uswhois.usUnited Statesianawiki8tt..us
tarttandeftartt.anwhois.anNetherlands Antillesianawiki7tt..an
tartufesdeftartuf.eswhois.esSpainianawiki8tt..es
tartuffesdeftartuff.eswhois.esSpainianawiki9tt..es
tartuffiandeftartuffi.anwhois.anNetherlands Antillesianawiki10tt..an
tartuffishdeftartuffi.shwhois.shSaint Helenaianawiki10tt..sh
tartuffishlydeftartuffish.lywhois.lyLibyan Arab Jamahiriyaianawiki12tt..ly
tartuffismdeftartuffi.smwhois.smSan Marinoianawiki10tt..sm
tartufiandeftartufi.anwhois.anNetherlands Antillesianawiki9tt..an
tartufishdeftartufi.shwhois.shSaint Helenaianawiki9tt..sh
tartufishlydeftartufish.lywhois.lyLibyan Arab Jamahiriyaianawiki11tt..ly
tartufismdeftartufi.smwhois.smSan Marinoianawiki9tt..sm
tartwomandeftartwom.anwhois.anNetherlands Antillesianawiki9tt..an
tarumadeftaru.mawhois.maMoroccoianawiki6tt..ma
taruntiusdeftarunti.uswhois.usUnited Statesianawiki9tt..us
tarvedeftar.vewhois.veVenezuelaianawiki5tt..ve
tarwaterdeftarwat.erwhois.erEritreaianawiki8tt..er
tarwhinedeftarwhi.newhois.neNigerianawiki8tt..ne
tarybadeftary.bawhois.baBosnia and Herzegovinaianawiki6tt..ba
tarynedeftary.newhois.neNigerianawiki6tt..ne
tarzandeftarz.anwhois.anNetherlands Antillesianawiki6tt..an
tarzanadeftarza.nawhois.naNamibiaianawiki7tt..na
tarzanishdeftarzani.shwhois.shSaint Helenaianawiki9tt..sh
tasdeft.aswhois.asAmerican Samoaianawiki3tt..as
tasajodeftasa.jowhois.joJordanianawiki6tt..jo
tascdefta.scwhois.scSeychellesianawiki4tt..sc
tascaldeftasc.alwhois.alAlbaniaianawiki6tt..al
tascodeftas.cowhois.coColombiaianawiki5tt..co
tascodefta.scowhois.scoScots languageN/Awiki5tt..sco
taseometerdeftaseomet.erwhois.erEritreaianawiki10tt..er
tashdefta.shwhois.shSaint Helenaianawiki4tt..sh
tashiedeftash.iewhois.ieIrelandianawiki6tt..ie
tashilamadeftashila.mawhois.maMoroccoianawiki9tt..ma
tashlichdeftashli.chwhois.chSwitzerlandianawiki8tt..ch
tashmitdeftashm.itwhois.itItalyianawiki7tt..it
tashnagistdeftashnagi.stwhois.stSao Tome and Principeianawiki10tt..st
tashnakistdeftashnaki.stwhois.stSao Tome and Principeianawiki10tt..st
tashusaideftashus.aiwhois.aiAnguillaianawiki8tt..ai
tasidefta.siwhois.siSloveniaianawiki4tt..si
tasiadeft.asiawhois.asiaDotAsia OrganizationN/Awiki5tt..asia
tasiandeftasi.anwhois.anNetherlands Antillesianawiki6tt..an
tasianadeftasia.nawhois.naNamibiaianawiki7tt..na
tasimeterdeftasimet.erwhois.erEritreaianawiki9tt..er
taskdefta.skwhois.skSlovak Republicianawiki4tt..sk
taskagedeftaska.gewhois.geGeorgiaianawiki7tt..ge
taskerdeftask.erwhois.erEritreaianawiki6tt..er
taskingdeftaski.ngwhois.ngNigeriaianawiki7tt..ng
taskitdeftask.itwhois.itItalyianawiki6tt..it
tasklikedeftaskli.kewhois.keKenyaianawiki8tt..ke
taskmasterdeftaskmast.erwhois.erEritreaianawiki10tt..er
tasksetterdeftasksett.erwhois.erEritreaianawiki10tt..er
tasksettingdeftasksetti.ngwhois.ngNigeriaianawiki11tt..ng
taskthemindwithdeftaskthemindwi.thwhois.thThailandianawiki15tt..th
taskwagedeftaskwa.gewhois.geGeorgiaianawiki8tt..ge
taskwithdeftaskwi.thwhois.thThailandianawiki8tt..th
tasletdeftasl.etwhois.etEthiopiaianawiki6tt..et
tasmdefta.smwhois.smSan Marinoianawiki4tt..sm
tasmandeftasm.anwhois.anNetherlands Antillesianawiki6tt..an
tasmaniandeftasmani.anwhois.anNetherlands Antillesianawiki9tt..an
tasmaniandevildeftasmaniandev.ilwhois.ilIsraelianawiki14tt..il
tasmaniantigerdeftasmaniantig.erwhois.erEritreaianawiki14tt..er
tassaldeftass.alwhois.alAlbaniaianawiki6tt..al
tassedeftas.sewhois.seSwedenianawiki5tt..se
tasselbushdeftasselbu.shwhois.shSaint Helenaianawiki10tt..sh
tasselerdeftassel.erwhois.erEritreaianawiki8tt..er
tasseletdeftassel.etwhois.etEthiopiaianawiki8tt..et
tasselfishdeftasselfi.shwhois.shSaint Helenaianawiki10tt..sh
tasselflowerdeftasselflow.erwhois.erEritreaianawiki12tt..er
tasselhungdeftasselhu.ngwhois.ngNigeriaianawiki10tt..ng
tasselhyacinthdeftasselhyacin.thwhois.thThailandianawiki14tt..th
tasselingdeftasseli.ngwhois.ngNigeriaianawiki9tt..ng
tassellerdeftassell.erwhois.erEritreaianawiki9tt..er
tassellingdeftasselli.ngwhois.ngNigeriaianawiki10tt..ng
tassellusdeftassell.uswhois.usUnited Statesianawiki9tt..us
tassellydeftassel.lywhois.lyLibyan Arab Jamahiriyaianawiki8tt..ly
tasselmakerdeftasselmak.erwhois.erEritreaianawiki11tt..er
tasselmakingdeftasselmaki.ngwhois.ngNigeriaianawiki12tt..ng
tasselsdeftasse.lswhois.lsLesothoianawiki7tt..ls
tasselstitchdeftasselstit.chwhois.chSwitzerlandianawiki12tt..ch
tasseltreedeftasseltr.eewhois.eeEstoniaianawiki10tt..ee
tasselweaverdeftasselweav.erwhois.erEritreaianawiki12tt..er
tasselydeftasse.lywhois.lyLibyan Arab Jamahiriyaianawiki7tt..ly
tasserdeftass.erwhois.erEritreaianawiki6tt..er
tassesdeftass.eswhois.esSpainianawiki6tt..es
tassetdeftass.etwhois.etEthiopiaianawiki6tt..et
tassiedeftass.iewhois.ieIrelandianawiki6tt..ie
tassiesdeftassi.eswhois.esSpainianawiki7tt..es
tassodeftas.sowhois.soSomaliaianawiki5tt..so
tastablydeftastab.lywhois.lyLibyan Arab Jamahiriyaianawiki8tt..ly
tasteablydeftasteab.lywhois.lyLibyan Arab Jamahiriyaianawiki9tt..ly
tastebeakerdeftastebeak.erwhois.erEritreaianawiki11tt..er
tastebulbdeftastebu.lbwhois.lbLebanonianawiki9tt..lb
tastefullydeftasteful.lywhois.lyLibyan Arab Jamahiriyaianawiki10tt..ly
tastegobletdeftastegobl.etwhois.etEthiopiaianawiki11tt..et
tastehairdeftasteha.irwhois.irIran, Islamic Republic ofianawiki9tt..ir
tasteinthemouthdeftasteinthemou.thwhois.thThailandianawiki15tt..th
tastekindeftastek.inwhois.inIndiaianawiki8tt..in
tastelesslydeftasteless.lywhois.lyLibyan Arab Jamahiriyaianawiki11tt..ly
tastelikedeftasteli.kewhois.keKenyaianawiki9tt..ke
tastelikeashesinthemouthdeftastelikeashesinthemou.thwhois.thThailandianawiki24tt..th
tastemakerdeftastemak.erwhois.erEritreaianawiki10tt..er
tastepaperdeftastepap.erwhois.erEritreaianawiki10tt..er
tasterdeftast.erwhois.erEritreaianawiki6tt..er
tastesdeftast.eswhois.esSpainianawiki6tt..es
tastierdeftasti.erwhois.erEritreaianawiki7tt..er
tastiestdeftastie.stwhois.stSao Tome and Principeianawiki8tt..st
tastilydeftasti.lywhois.lyLibyan Arab Jamahiriyaianawiki7tt..ly
tastingdeftasti.ngwhois.ngNigeriaianawiki7tt..ng
tastinglydeftasting.lywhois.lyLibyan Arab Jamahiriyaianawiki9tt..ly
tastingsdeftastin.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki8tt..gs
tasudefta.suwhois.suSoviet UnionN/Awiki4tt..su
tatdeft.atwhois.atAustriaianawiki3tt..at
tatamisdeftatam.iswhois.isIcelandianawiki7tt..is
tatamydeftata.mywhois.myMalaysiaianawiki6tt..my
tatardeftat.arwhois.arArgentinaianawiki5tt..ar
tatariandeftatari.anwhois.anNetherlands Antillesianawiki8tt..an
tatarstraitdeftatarstra.itwhois.itItalyianawiki11tt..it
tataupadeftatau.pawhois.paPanamaianawiki7tt..pa
taterdeftat.erwhois.erEritreaianawiki5tt..er
tatesdeftat.eswhois.esSpainianawiki5tt..es
tathdefta.thwhois.thThailandianawiki4tt..th
tatiandeftati.anwhois.anNetherlands Antillesianawiki6tt..an
tatianadeftatia.nawhois.naNamibiaianawiki7tt..na
tatianasdeftatian.aswhois.asAmerican Samoaianawiki8tt..as
tatianistdeftatiani.stwhois.stSao Tome and Principeianawiki9tt..st
tatiannadeftatian.nawhois.naNamibiaianawiki8tt..na
tatiedeftat.iewhois.ieIrelandianawiki5tt..ie
tatiusdeftati.uswhois.usUnited Statesianawiki6tt..us
tatlerdeftatl.erwhois.erEritreaianawiki6tt..er
tatmandeftatm.anwhois.anNetherlands Antillesianawiki6tt..an
tatmjolkdeftatmjo.lkwhois.lkSri Lankaianawiki8tt..lk
tatoupebadeftatoupe.bawhois.baBosnia and Herzegovinaianawiki9tt..ba
tatsanottinedeftatsanotti.newhois.neNigerianawiki12tt..ne
tatsmandeftatsm.anwhois.anNetherlands Antillesianawiki7tt..an
tattandeftatt.anwhois.anNetherlands Antillesianawiki6tt..an
tattatdeftatt.atwhois.atAustriaianawiki6tt..at
tattattatdeftattatt.atwhois.atAustriaianawiki9tt..at
tatterdeftatt.erwhois.erEritreaianawiki6tt..er
tatterdemalionismdeftatterdemalioni.smwhois.smSan Marinoianawiki17tt..sm
tatteredlydeftattered.lywhois.lyLibyan Arab Jamahiriyaianawiki10tt..ly
tatteringdeftatteri.ngwhois.ngNigeriaianawiki9tt..ng
tatterlydeftatter.lywhois.lyLibyan Arab Jamahiriyaianawiki8tt..ly
tattersallsdeftattersal.lswhois.lsLesothoianawiki11tt..ls
tatterwagdeftatterw.agwhois.agAntigua and Barbudaianawiki9tt..ag
tattherdeftatth.erwhois.erEritreaianawiki7tt..er
tattiedeftatt.iewhois.ieIrelandianawiki6tt..ie
tattieliftingdeftattielifti.ngwhois.ngNigeriaianawiki13tt..ng
tattierdeftatti.erwhois.erEritreaianawiki7tt..er
tattiesdeftatti.eswhois.esSpainianawiki7tt..es
tattiestdeftattie.stwhois.stSao Tome and Principeianawiki8tt..st
tattilydeftatti.lywhois.lyLibyan Arab Jamahiriyaianawiki7tt..ly
tattingdeftatti.ngwhois.ngNigeriaianawiki7tt..ng
tattingsdeftattin.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki8tt..gs
tattlerdeftattl.erwhois.erEritreaianawiki7tt..er
tattlesdeftattl.eswhois.esSpainianawiki7tt..es
tattletalesdeftattletal.eswhois.esSpainianawiki11tt..es
tattlingdeftattli.ngwhois.ngNigeriaianawiki8tt..ng
tattlinglydeftattling.lywhois.lyLibyan Arab Jamahiriyaianawiki10tt..ly
tattooagedeftattooa.gewhois.geGeorgiaianawiki9tt..ge
tattooerdeftattoo.erwhois.erEritreaianawiki8tt..er
tattooingdeftattooi.ngwhois.ngNigeriaianawiki9tt..ng
tattooistdeftattooi.stwhois.stSao Tome and Principeianawiki9tt..st
tattvadeftatt.vawhois.vaHoly See (Vatican City State)ianawiki6tt..va
tattvamasideftattvama.siwhois.siSloveniaianawiki10tt..si
tattypeelindeftattypeel.inwhois.inIndiaianawiki11tt..in
tatuasudeftatua.suwhois.suSoviet UnionN/Awiki7tt..su
tatumdeftat.umwhois.umUnited States Minor Outlying Islandsianawiki5tt..um
tatumsdeftatu.mswhois.msMontserratianawiki6tt..ms
tatusiidaedeftatusiid.aewhois.aeUnited Arab Emiratesianawiki10tt..ae
tatyanakhodorovichdeftatyanakhodorovi.chwhois.chSwitzerlandianawiki18tt..ch
taudeft.auwhois.auAustraliaianawiki3tt..au
taubedeftau.bewhois.beBelgiumianawiki5tt..be
tauchnitzdeftauchni.tzwhois.tzTanzaniaianawiki9tt..tz
taughtdeftaug.htwhois.htHaitiianawiki6tt..ht
tauladeftau.lawhois.laLao People's Democratic Republicianawiki5tt..la
taulchdeftaul.chwhois.chSwitzerlandianawiki6tt..ch
taulideftau.liwhois.liLiechtensteinianawiki5tt..li
taumdefta.umwhois.umUnited States Minor Outlying Islandsianawiki4tt..um
taungthudeftaungt.huwhois.huHungaryianawiki8tt..hu
taunterdeftaunt.erwhois.erEritreaianawiki7tt..er
tauntingdeftaunti.ngwhois.ngNigeriaianawiki8tt..ng
tauntinglydeftaunting.lywhois.lyLibyan Arab Jamahiriyaianawiki10tt..ly
tauntwithdeftauntwi.thwhois.thThailandianawiki9tt..th
taupedeftau.pewhois.pePeruianawiki5tt..pe
tauperosedeftaupero.sewhois.seSwedenianawiki9tt..se
taupesdeftaup.eswhois.esSpainianawiki6tt..es
taurangadeftauran.gawhois.gaGabonianawiki8tt..ga
taureandeftaure.anwhois.anNetherlands Antillesianawiki7tt..an
tauriandeftauri.anwhois.anNetherlands Antillesianawiki7tt..an
tauricidedeftaurici.dewhois.deGermanyianawiki9tt..de
tauricornousdeftauricorno.uswhois.usUnited Statesianawiki12tt..us
tauriddeftaur.idwhois.idIndonesiaianawiki6tt..id
tauridiandeftauridi.anwhois.anNetherlands Antillesianawiki9tt..an
tauriferousdeftaurifero.uswhois.usUnited Statesianawiki11tt..us
taurindeftaur.inwhois.inIndiaianawiki6tt..in
taurinedeftauri.newhois.neNigerianawiki7tt..ne
taurinesdeftaurin.eswhois.esSpainianawiki8tt..es
taurinideftauri.niwhois.niNicaraguaianawiki7tt..ni
taurodeftau.rowhois.roRomaniaianawiki5tt..ro
tauroboliumdeftauroboli.umwhois.umUnited States Minor Outlying Islandsianawiki11tt..um
taurobolydeftaurobo.lywhois.lyLibyan Arab Jamahiriyaianawiki9tt..ly
taurocephalousdeftaurocephalo.uswhois.usUnited Statesianawiki14tt..us
taurocholicaciddeftaurocholicac.idwhois.idIndonesiaianawiki15tt..id
taurocolladeftaurocol.lawhois.laLao People's Democratic Republicianawiki10tt..la
tauroctonusdeftaurocton.uswhois.usUnited Statesianawiki11tt..us
tauromachiandeftauromachi.anwhois.anNetherlands Antillesianawiki12tt..an
tauromorphousdeftauromorpho.uswhois.usUnited Statesianawiki13tt..us
taurophobedeftauropho.bewhois.beBelgiumianawiki10tt..be
taurotragusdeftaurotrag.uswhois.usUnited Statesianawiki11tt..us
taurusdeftaur.uswhois.usUnited Statesianawiki6tt..us
taurusclusterdeftaurusclust.erwhois.erEritreaianawiki13tt..er
taurusesdeftaurus.eswhois.esSpainianawiki8tt..es
tausdefta.uswhois.usUnited Statesianawiki4tt..us
tautasabowstringdeftautasabowstri.ngwhois.ngNigeriaianawiki16tt..ng
tautaugdeftauta.ugwhois.ugUgandaianawiki7tt..ug
tautaugsdeftautau.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki8tt..gs
tautegoricaldeftautegoric.alwhois.alAlbaniaianawiki12tt..al
tauteningdeftauteni.ngwhois.ngNigeriaianawiki9tt..ng
tauterdeftaut.erwhois.erEritreaianawiki6tt..er
tautestdeftaute.stwhois.stSao Tome and Principeianawiki7tt..st
tautestdeftau.testwhois.testPrivate TestingN/Awiki7tt..test
tautingdeftauti.ngwhois.ngNigeriaianawiki7tt..ng
tautitdeftaut.itwhois.itItalyianawiki6tt..it
tautlydeftaut.lywhois.lyLibyan Arab Jamahiriyaianawiki6tt..ly
tautnessesdeftautness.eswhois.esSpainianawiki10tt..es
tautodeftau.towhois.toTongaianawiki5tt..to
tautochronedeftautochro.newhois.neNigerianawiki11tt..ne
tautochronismdeftautochroni.smwhois.smSan Marinoianawiki13tt..sm
tautochronousdeftautochrono.uswhois.usUnited Statesianawiki13tt..us
tautogsdeftauto.gswhois.gsSouth Georgia & South Sandwich Islandsianawiki7tt..gs
tautoisomerismdeftautoisomeri.smwhois.smSan Marinoianawiki14tt..sm
tautologicaldeftautologic.alwhois.alAlbaniaianawiki12tt..al
tautologicallydeftautological.lywhois.lyLibyan Arab Jamahiriyaianawiki14tt..ly
tautologiesdeftautologi.eswhois.esSpainianawiki11tt..es
tautologisedeftautologi.sewhois.seSwedenianawiki11tt..se
tautologisingdeftautologisi.ngwhois.ngNigeriaianawiki13tt..ng
tautologismdeftautologi.smwhois.smSan Marinoianawiki11tt..sm
tautologistdeftautologi.stwhois.stSao Tome and Principeianawiki11tt..st
tautologizerdeftautologiz.erwhois.erEritreaianawiki12tt..er
tautologizingdeftautologizi.ngwhois.ngNigeriaianawiki13tt..ng
tautologousdeftautologo.uswhois.usUnited Statesianawiki11tt..us
tautologouslydeftautologous.lywhois.lyLibyan Arab Jamahiriyaianawiki13tt..ly
tautologydeftautolo.gywhois.gyGuyanaianawiki9tt..gy
tautomerdeftautom.erwhois.erEritreaianawiki8tt..er
tautomeraldeftautomer.alwhois.alAlbaniaianawiki10tt..al
tautomerismdeftautomeri.smwhois.smSan Marinoianawiki11tt..sm
tautomerizingdeftautomerizi.ngwhois.ngNigeriaianawiki13tt..ng
tautometerdeftautomet.erwhois.erEritreaianawiki10tt..er
tautometricaldeftautometric.alwhois.alAlbaniaianawiki13tt..al
tautomorphousdeftautomorpho.uswhois.usUnited Statesianawiki13tt..us
tautonymiesdeftautonymi.eswhois.esSpainianawiki11tt..es
tautonymousdeftautonymo.uswhois.usUnited Statesianawiki11tt..us
tautonymsdeftautony.mswhois.msMontserratianawiki9tt..ms
tautonymydeftautony.mywhois.myMalaysiaianawiki9tt..my
tautoousiandeftautoousi.anwhois.anNetherlands Antillesianawiki11tt..an
tautoousiousdeftautoousio.uswhois.usUnited Statesianawiki12tt..us
tautophonicaldeftautophonic.alwhois.alAlbaniaianawiki13tt..al
tautotypedeftautoty.pewhois.pePeruianawiki9tt..pe
tautousiandeftautousi.anwhois.anNetherlands Antillesianawiki10tt..an
tautousiousdeftautousio.uswhois.usUnited Statesianawiki11tt..us
tautozonaldeftautozon.alwhois.alAlbaniaianawiki10tt..al
tavaresdeftavar.eswhois.esSpainianawiki7tt..es
tavastdeftava.stwhois.stSao Tome and Principeianawiki6tt..st
tavastiandeftavasti.anwhois.anNetherlands Antillesianawiki9tt..an
tavedefta.vewhois.veVenezuelaianawiki4tt..ve
taverdeftav.erwhois.erEritreaianawiki5tt..er
tavernadeftaver.nawhois.naNamibiaianawiki7tt..na
tavernasdeftavern.aswhois.asAmerican Samoaianawiki8tt..as
taverncardeftavernc.arwhois.arArgentinaianawiki9tt..ar
tavernerdeftavern.erwhois.erEritreaianawiki8tt..er
tavernhuntingdeftavernhunti.ngwhois.ngNigeriaianawiki13tt..ng
tavernierdeftaverni.erwhois.erEritreaianawiki9tt..er
tavernlikedeftavernli.kewhois.keKenyaianawiki10tt..ke
tavernlydeftavern.lywhois.lyLibyan Arab Jamahiriyaianawiki8tt..ly
tavernousdeftaverno.uswhois.usUnited Statesianawiki9tt..us
tavestockdeftavesto.ckwhois.ckCook Islandsianawiki9tt..ck
tavgideftav.giwhois.giGibraltarianawiki5tt..gi
tavidefta.viwhois.viVirgin Islands, U.S.ianawiki4tt..vi
taviedeftav.iewhois.ieIrelandianawiki5tt..ie
tavisdeftav.iswhois.isIcelandianawiki5tt..is
tavishdeftavi.shwhois.shSaint Helenaianawiki6tt..sh
tavoladeftavo.lawhois.laLao People's Democratic Republicianawiki6tt..la
tawdeft.awwhois.awArubaianawiki3tt..aw
tawdrierdeftawdri.erwhois.erEritreaianawiki8tt..er
tawdriesdeftawdri.eswhois.esSpainianawiki8tt..es
tawdriestdeftawdrie.stwhois.stSao Tome and Principeianawiki9tt..st
tawdrilydeftawdri.lywhois.lyLibyan Arab Jamahiriyaianawiki8tt..ly
tawedleatherdeftawedleath.erwhois.erEritreaianawiki12tt..er
tawerdeftaw.erwhois.erEritreaianawiki5tt..er
tawgideftaw.giwhois.giGibraltarianawiki5tt..gi
tawhaideftawh.aiwhois.aiAnguillaianawiki6tt..ai
tawhiddeftawh.idwhois.idIndonesiaianawiki6tt..id
tawiedeftaw.iewhois.ieIrelandianawiki5tt..ie
tawingdeftawi.ngwhois.ngNigeriaianawiki6tt..ng
tawkeedeftawk.eewhois.eeEstoniaianawiki6tt..ee
tawkindeftawk.inwhois.inIndiaianawiki6tt..in
tawlinedeftawli.newhois.neNigerianawiki7tt..ne
tawneierdeftawnei.erwhois.erEritreaianawiki8tt..er
tawneiestdeftawneie.stwhois.stSao Tome and Principeianawiki9tt..st
tawniedeftawn.iewhois.ieIrelandianawiki6tt..ie
tawnierdeftawni.erwhois.erEritreaianawiki7tt..er
tawniesdeftawni.eswhois.esSpainianawiki7tt..es
tawniestdeftawnie.stwhois.stSao Tome and Principeianawiki8tt..st
tawnilydeftawni.lywhois.lyLibyan Arab Jamahiriyaianawiki7tt..ly
tawnyolivedeftawnyoli.vewhois.veVenezuelaianawiki10tt..ve
tawpiedeftawp.iewhois.ieIrelandianawiki6tt..ie
tawpiesdeftawpi.eswhois.esSpainianawiki7tt..es
tawpydeftaw.pywhois.pyParaguayianawiki5tt..py
tawsdefta.wswhois.wsWestern Samoaianawiki4tt..ws
tawsedeftaw.sewhois.seSwedenianawiki5tt..se
tawsesdeftaws.eswhois.esSpainianawiki6tt..es
tawsingdeftawsi.ngwhois.ngNigeriaianawiki7tt..ng
tawsugdeftaws.ugwhois.ugUgandaianawiki6tt..ug
tawsydeftaw.sywhois.sySyrian Arab Republicianawiki5tt..sy
tawtiedeftawt.iewhois.ieIrelandianawiki6tt..ie
tawyerdeftawy.erwhois.erEritreaianawiki6tt..er
taxdeft.axwhois.axAland Islandsianawiki3tt..ax
taxablesdeftaxabl.eswhois.esSpainianawiki8tt..es
taxablydeftaxab.lywhois.lyLibyan Arab Jamahiriyaianawiki7tt..ly
taxaceaedeftaxace.aewhois.aeUnited Arab Emiratesianawiki8tt..ae
taxaceousdeftaxaceo.uswhois.usUnited Statesianawiki9tt..us
taxameterdeftaxamet.erwhois.erEritreaianawiki9tt..er
taxaspideandeftaxaspide.anwhois.anNetherlands Antillesianawiki11tt..an
taxationaldeftaxation.alwhois.alAlbaniaianawiki10tt..al
taxativedeftaxati.vewhois.veVenezuelaianawiki8tt..ve
taxativelydeftaxative.lywhois.lyLibyan Arab Jamahiriyaianawiki10tt..ly
taxbasedeftaxba.sewhois.seSwedenianawiki7tt..se
taxbenefitdeftaxbenef.itwhois.itItalyianawiki10tt..it
taxboughtdeftaxboug.htwhois.htHaitiianawiki9tt..ht
taxcollectingdeftaxcollecti.ngwhois.ngNigeriaianawiki13tt..ng
taxcreditdeftaxcred.itwhois.itItalyianawiki9tt..it
taxdodgerdeftaxdodg.erwhois.erEritreaianawiki9tt..er
taxdodgingdeftaxdodgi.ngwhois.ngNigeriaianawiki10tt..ng
taxeaterdeftaxeat.erwhois.erEritreaianawiki8tt..er
taxeatingdeftaxeati.ngwhois.ngNigeriaianawiki9tt..ng
taxemesdeftaxem.eswhois.esSpainianawiki7tt..es
taxeopodousdeftaxeopodo.uswhois.usUnited Statesianawiki11tt..us
taxerdeftax.erwhois.erEritreaianawiki5tt..er
taxesdeftax.eswhois.esSpainianawiki5tt..es
taxevaderdeftaxevad.erwhois.erEritreaianawiki9tt..er
taxexemptdeftaxexem.ptwhois.ptPortugalianawiki9tt..pt
taxexemptstatusdeftaxexemptstat.uswhois.usUnited Statesianawiki15tt..us
taxfarmerdeftaxfarm.erwhois.erEritreaianawiki9tt..er
taxfreedeftaxfr.eewhois.eeEstoniaianawiki7tt..ee
taxgathererdeftaxgather.erwhois.erEritreaianawiki11tt..er
taxgatheringdeftaxgatheri.ngwhois.ngNigeriaianawiki12tt..ng
taxiarchdeftaxiar.chwhois.chSwitzerlandianawiki8tt..ch
taxiautodeftaxiau.towhois.toTongaianawiki8tt..to
taxibusdeftaxib.uswhois.usUnited Statesianawiki7tt..us
taxicabsdeftaxica.bswhois.bsBahamasianawiki8tt..bs
taxidancerdeftaxidanc.erwhois.erEritreaianawiki10tt..er
taxidermaldeftaxiderm.alwhois.alAlbaniaianawiki10tt..al
taxidermiesdeftaxidermi.eswhois.esSpainianawiki11tt..es
taxidermistdeftaxidermi.stwhois.stSao Tome and Principeianawiki11tt..st
taxidermydeftaxider.mywhois.myMalaysiaianawiki9tt..my
taxidriverdeftaxidriv.erwhois.erEritreaianawiki10tt..er
taxiesdeftaxi.eswhois.esSpainianawiki6tt..es
taxiingdeftaxii.ngwhois.ngNigeriaianawiki7tt..ng
taxiladeftaxi.lawhois.laLao People's Democratic Republicianawiki6tt..la
taximandeftaxim.anwhois.anNetherlands Antillesianawiki7tt..an
taximeterdeftaximet.erwhois.erEritreaianawiki9tt..er
taxindeftax.inwhois.inIndiaianawiki5tt..in
taxinedeftaxi.newhois.neNigerianawiki6tt..ne
taxingdef